KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2081
Entry
STM2081           CDS       T00065                                 

Gene name
gnd
Definition
(RefSeq) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00030  Pentose phosphate pathway
stm00480  Glutathione metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01200  Carbon metabolism
Module
stm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
stm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STM2081 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STM2081 (gnd)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     STM2081 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     STM2081 (gnd)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH F420_oxidored 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Other DBs
NCBI-GeneID: 1253602
NCBI-ProteinID: NP_461026
UniProt: P14062
Position
complement(2159358..2160764)
AA seq 468 aa
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVKEF
VESLETPRRILLMVKAGAGTDAAIDSLKPYLEKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKDAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLSNEELANTFTEWNNGELSSYLIDITKDIFT
KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKAQRVAAS
KVLSGPKAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYHWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENADIANLLLAPYFKKIADEYQQALRDVVAYAVQNGIPVPT
FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtccaagcaacagatcggcgtcgtcggtatggcagtgatggggcgcaacctcgcgctc
aacatcgaaagccgtggttataccgtctccgttttcaaccgctcccgtgaaaagaccgaa
gaagtgattgccgagaatcccggcaaaaagctggtgccttattacacggtgaaagagttt
gttgaatccctcgaaacgcctcgtcgtatcctgttaatggtgaaagcgggcgcaggtact
gatgcagctatcgattcgctgaaaccgtatctggaaaaaggcgatatcattattgatggc
ggtaacaccttcttccaggacacaatccgtcgcaatcgcgagctgtctgcggaaggtttt
aactttatcggtaccggtgtttccggtggtgaagagggcgcgctgaaagggccatctatc
atgcctggcggtcagaaagatgcctatgaactggtggcgccgatcctgacgaagattgct
gctgtggcagaagatggcgaaccgtgcgtgacctatatcggcgccgatggtgctggtcac
tacgtcaagatggtccacaatggtattgaatatggcgatatgcagcttatcgctgaagct
tactccctgctgaaaggcggcctgaatctcagcaatgaagagttggcgaacacttttact
gagtggaataacggcgagctgagcagctatctgatcgacatcactaaagacatcttcact
aaaaaagatgaagacggaaactacctggtggatgtcattcttgatgaagccgccaacaaa
gggaccggtaaatggaccagccagagcgcgctggatctgggtgaaccgctgtcgctgatt
accgaatccgtctttgcgcgttacatctcttcgttgaaagcgcaacgtgttgccgcatct
aaagtgctctccgggccgaaagcgcagccggcaggcgacaaagctgaatttatcgagaaa
gtgcgtcgcgcgctgtatcttggcaagatcgtctcctatgcgcagggcttctcgcagcta
cgcgccgcgtctgatgaatatcactgggatctcaactacggcgagattgctaagattttc
cgggcgggctgtatcattcgcgctcagttcctgcagaagatcaccgatgcttacgcagaa
aacgccgatatcgctaacttgctgttagcgccttacttcaagaaaattgctgatgagtac
cagcaggcgctgcgcgatgtcgtggcttacgcggtgcagaacggcattccggtgccgaca
ttctctgcggcagtggcctactatgacagctatcgcgccgcagtactgccagctaactta
attcaggcgcagcgtgactactttggtgcgcacacctataaacgtactgataaagaaggc
attttccataccgaatggttggaataa

DBGET integrated database retrieval system