KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2218
Entry
STM2218           CDS       T00065                                 

Symbol
yejE
Name
(RefSeq) microcin ABC transporter permease
  KO
K13895  microcin C transport system permease protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2218 (yejE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2218 (yejE)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Microcin C transporter
    STM2218 (yejE)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N ABC_membrane_3
Other DBs
NCBI-GeneID: 1253740
NCBI-ProteinID: NP_461162
UniProt: Q8ZNJ9
Position
2319127..2320152
AA seq 341 aa
MPRLSPVNQARWARFRHNRRGYWSLWIFLVVFSLSLCAELIANDKPLLVRYEGQWYFPLV
KNYSERDFGGPLATTADYQDPWLQRQLENRGWVLWAPVRFSANTINFATTQPFPSPPSAK
NWLGTDANGGDVFARILYGTRISILFGLMLTICSSVMGVLAGALQGYYGGKVDLWGQRLI
EVWSGMPTLFLIILLSSVVQPNFWWLLAITVLFGWMSLVGVVRAEFLRTRNFDYIRAAQA
LGVSDRDIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQG
KNNLQAPWLGIAAFLSVAILLSLLIFIGEAVRDAFDPAKAV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgccgcgattaagcccggtcaatcaggcccgctgggcgcgtttccgccataatcgccgg
ggctactggtcactatggattttcctggtcgtgttcagcctgagcttatgcgcggaactg
attgctaacgataagccattgctggtgcgctatgaaggccagtggtattttccgctggta
aaaaattacagcgagcgcgatttcggcggcccgctggcgacaacggcggattatcaggac
ccctggctacaacggcagcttgagaatcggggctgggtgttgtgggcccccgtacgcttt
agtgccaataccattaattttgccaccacgcagcctttcccctccccgccttcggcgaaa
aactggctgggcaccgatgcgaatggcggcgacgttttcgcccgcatcctgtacggcacc
cgcatttctattttattcggcctgatgttaacgatttgctccagcgtcatgggcgtactg
gcgggcgcgctacagggctattatggcggcaaagtcgatttatggggacaacgtctcatc
gaagtctggtcggggatgccgaccctgtttctgattattttactttccagcgtagtgcag
cctaacttctggtggctgctggccataaccgtgctgtttggctggatgagtctggtgggc
gtggtgcgcgccgagtttttacggacccgcaattttgactatatccgcgccgcgcaggcg
cttggcgtcagcgatcgtgacattatcctgcgccatatgttgcctaatgcgatggtcgct
accctgacatttttaccgttcattttatgtagctccatcaccaccctgacgtcgctggat
tttctgggattcggtctgccgcttggctccccttctctcggcgaacttcttttacagggg
aaaaacaacttacaggctccctggctggggatcgccgcctttctgtctgtcgccattctg
ctatcgctgctgatttttatcggcgaagcggtacgcgacgcctttgatcctgctaaggcg
gtataa

DBGET integrated database retrieval system