KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2219
Entry
STM2219           CDS       T00065                                 

Symbol
yejF
Name
(RefSeq) microcin C ABC transporter ATP-binding protein YejF
  KO
K13896  microcin C transport system ATP-binding protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2219 (yejF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2219 (yejF)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Microcin C transporter
    STM2219 (yejF)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 oligo_HPY AAA_16 AAA_22 AAA_29 AAA_13 SbcC_Walker_B AIG1 AAA_5 DUF87 AAA_25 AAA_7 AAA_33 Mg_chelatase
Other DBs
NCBI-GeneID: 1253741
NCBI-ProteinID: NP_461163
UniProt: Q8ZNJ8
Position
2320154..2321743
AA seq 529 aa
MTSPLLAIENLSVGFRQQQHVRPVVNAISLQVNAGETLALVGESGSGKSVTALSILRLLP
TPPAVYLSGDIRFHGESLLHASEQTLRGVRGNKIAMIFQEPMVSLNPLHTLEKQLYEVLS
LHRGMSREAARAEMIGCLDRVGIRQASQRLRDYPHQLSGGERQRVMIAMALLTRPELLIA
DEPTTALDVSVQAQILSLLRELQRELNMGLLFITHNLSIVKKLADSVAVMQHGKCVENQR
ADTLLSAPTHPYTQKLLNSEPTGDPVPLPAGQAPLLEVDKLRVAFPIRKGILKRVVDHNV
VVNNISFTLHPGETLGLVGESGSGKSTTGLALLRLIRSEGRIVFDGQSLDTLNRRQLLPV
RHRIQVVFQDPNSSLNPRLNVLQIIEEGLRVHQPTLSGAQREQQVKAVMMEVGLDPETRH
RYPAEFSGGQRQRIAVARALILKPSLIILDEPTSSLDKTVQAQILALLKSLQQKHRLAYI
FISHDLHVVRALCHQVIVLRQGEVVEQGQCERVFTAPQQAYTRQLLALS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgacatctccattgcttgcgattgaaaatttatcggtaggtttccgtcagcaacagcac
gtgcgccctgtcgttaacgccatttcgttacaggtgaacgccggggaaacgctggcgctg
gtcggcgagtcagggtcagggaaaagcgtgacggcgctttccattctgcgtcttttgcct
acccctcccgccgtctacctctccggcgatattcgctttcacggcgaatcattgcttcat
gccagcgagcagacgttacgcggcgtgcgcggcaataaaatcgccatgatttttcaggaa
ccgatggtttcacttaacccactgcatacgctggaaaaacagctctatgaagtgctgtcg
ctccatcggggaatgagtcgggaggcggcaagggcggagatgatcggttgtctggatcgg
gtcggtatccgccaggcgagccagcgtctgcgcgattatccgcatcagctttccggcggc
gaacgccagcgcgtcatgatagccatggcgctgttaacacggccggaattactgatcgcc
gatgagccgaccaccgccctcgacgtctccgtacaggcgcagatcttatctctactgcgg
gaactccagcgcgagctcaatatgggattgctgtttatcacccataacctcagcattgta
aaaaaactggcggattcagtggcggtaatgcaacacggcaagtgcgtagagaaccaacgc
gccgacacgctgctctccgcgccgacccatccgtacacgcaaaaactactcaacagcgaa
cccactggcgatccggttccgctccccgccgggcaggcgccgttgctggaagtggacaag
ctgcgcgtcgccttcccaatccgcaaaggcattctgaagcgcgtcgtggatcataatgtg
gtggttaacaatatcagtttcaccctgcatccaggcgaaacgctgggtctggtcggcgag
tcaggatcgggaaaaagcaccaccggtctggcgctgttacggcttatccgctccgaaggc
cgcatcgtgtttgacggtcaatcgctggatacgttaaaccgccgccagcttttacctgtt
cgccaccgtatccaggtcgtattccaggacccgaactcatcgctaaacccgcgtttaaac
gtattgcaaattatcgaagaaggcctgcgcgtccaccagcctacgctttcaggcgcgcag
cgcgaacagcaggtgaaagcggtcatgatggaagtcggcctggacccggaaacgcggcat
cgttaccccgctgagttttccggcggccagcgtcaacgtatcgccgtcgccagggcactg
attttaaaaccgtcgcttattattctggatgaaccgacctcatcgctggataaaaccgtt
caggcgcagattcttgccctcctgaaatcgctccagcaaaagcaccgtctggcctatatc
ttcattagccacgatctgcatgtagtacgcgcgctgtgccatcaggttattgtgctgcgg
cagggggaggtggttgaacaggggcaatgcgagcgcgtgtttaccgcaccgcaacaggcc
tatacgcgtcagctactcgcgttaagctga

DBGET integrated database retrieval system