KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2321Help
Entry
STM2321           CDS       T00065                                 

Gene name
nuoI
Definition
(RefSeq) NADH-quinone oxidoreductase subunit I
  KO
K00338  NADH-quinone oxidoreductase subunit I [EC:1.6.5.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00190  Oxidative phosphorylation
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    STM2321 (nuoI)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     STM2321 (nuoI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_21 Fer4_16 Fer4_10 Fer4_8 Fer4_9 Fer4_2 Fer4_6 Fer4_17 Fer4_4 Fer4_13 Fer4_3 ETF_QO
Motif
Other DBs
NCBI-GeneID: 1253843
NCBI-ProteinID: NP_461263
UniProt: Q7CQ51
Position
complement(2430362..2430904)
Genome map
AA seq 180 aa AA seqDB search
MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERC
VACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDF
ELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaaaagaattattagtaggtttcggcactcaggtacgcagtatctggatgatc
ggcctgcatgcgttcgccaaacgcgaaacgcggatgtatccggaagagccggtctattta
ccgccccgttaccgtggtcgtatcgtgctcacgcgcgacccggacggtgaagagcgctgc
gttgcctgtaacctgtgcgcggtagcctgtccggtaggctgtatctctctgcaaaaagcg
gagaccaaagatggccgctggtatccggaatttttccgcattaacttctcacgctgcatc
ttctgcggcctgtgcgaagaagcgtgcccgaccacggcgattcagttgaccccggacttc
gaactgggcgaatacaaacgtcaggatctggtgtacgaaaaagaggatctgctgatttcc
ggtccgggcaaatacccggaatataacttctaccggatggcgggtatggcaatcgacggc
aaagataaaggcgaagcagagaacgaagccaagcctatcgacgtcaagagcctgttaccg
taa

DBGET integrated database retrieval system