KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2323Help
Entry
STM2323           CDS       T00065                                 

Gene name
nuoG
Definition
(RefSeq) NADH dehydrogenase I chain G
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADH-G_4Fe-4S_3 Fer2_4 Molybdop_Fe4S4 Molybdopterin Fer2 Molydop_binding TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 1253845
NCBI-ProteinID: NP_461265
UniProt: P0A1Y4
Position
complement(2431893..2434625)
Genome map
AA seq 910 aa AA seqDB search
MLMATIHVDGKEYEVNGADNLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNAED
TRGRLVMSCMTPATDGTFISIDDEEAKQFRESVVEWLMTNHPHDCPVCEEGGNCHLQDMT
VMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDN
VYFGRPEDGTLESEFSGNLVEICPTGVFTDKTHSERYNRKWDMQFAPSICQQCSIGCNIS
PGERYGELRRIENRYNGTVNHYFLCDRGRFGYGYVNLKDRPRQPVQRRGDDFITLNAEQA
MQGAADILRQSKKVIGIGSPRASIESNFALRELVGAENFYTGIARGEQERLQLALKVLRE
GGIYTPALREIESYDAVLVLGEDVTQTGARVALAVRQAVKGKAREMAAAQKVADWQIAAI
LNIGQRAKHPLFVTNVDDTRLDDIAAWTYRAPVEDQARLGFAIAHALDNTAPAVDGIDSD
LQNKIDVIVQALAGAKKPLIISGTNAGSSEVIQAAANVAKALKGRGADVGITMIARSVNS
MGLGMMGGGSLDDALGELETGSADAVVVLENDLHRHASATRVNAALAKAPLVMVVDHQRT
AIMENAHLVLSAASFAESDGTVINNEGRAQRFFQVYDPAYYDNKTIMLESWRWLHSLHST
VENREVDWTQLDHVIDAVIAAMPQFAGIKDAAPDATFRIRGQKLAREPHRYSGRTAMRAN
ISVHEPRQPQDKDTMFAFSMEGNNQPTAPRSEIPFAWAPGWNSPQAWNKFQDEVGGKLRH
GDPGVRLIEATEGGLDYFTTVPASFQAQDGQWRIAPYYHLFGSDELSQRSPVFQSRMPQP
YIKLNPADAAKLGVNAGTRVSFSYDGNTVTLPVEISEGLAAGQVGLPMGMPGIAPVLAGA
RLEDLREAQQ
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgctaatggctacgattcatgtagacggcaaagaatacgaggtcaatggcgcggacaac
ctgctacaggcatgtctgtccctcggccttgatattccgtatttttgctggcacccggcg
ctgggaagcgtcggtgcttgccgccagtgtgcggtgaagcaataccaaaacgcggaagat
acgcgtggtcgcctggtgatgtcctgtatgacgccagccaccgacggtacctttatctct
attgacgacgaagaagcgaaacagttccgtgaaagcgtggtggagtggctgatgactaac
cacccgcacgactgtccggtctgtgaagagggcggtaactgccatcttcaggatatgacc
gtgatgacggggcacagtttccgtcgctaccgtttcaccaaacgtacccaccgcaaccag
gatctggggccgttcatctcgcacgaaatgaaccgctgcatcgcctgctaccgttgtgtg
cgttactacaaagattatgccgacggcaccgatctgggcgtctatggcgcgcatgacaac
gtctacttcgggcgtccggaagacggtacgctggaaagcgaattctccggtaacctggtc
gagatttgcccgaccggcgtcttcaccgataaaacgcactccgagcgttacaaccgtaaa
tgggacatgcagtttgcgccgagcatctgtcagcagtgttccatcggctgtaacatcagc
ccgggcgagcgctatggcgaattacgccgtatcgaaaaccgttacaacggtaccgttaac
cactacttcctctgcgaccgcggtcgtttcggctatggctatgtgaacctgaaagaccgt
ccgcgtcagccggttcagcgccgtggcgatgacttcatcaccctcaacgccgagcaggcg
atgcagggcgcggcggatattctgcgccagtcgaagaaagtgatcggtatcggttcgcca
cgcgccagcattgagagcaactttgcgctgcgtgagctggttggtgcggaaaacttctac
accggtatcgcgcgcggcgagcaggaacgtctgcaactggcgctgaaagtgctgcgtgaa
ggcggaatttacaccccggcgctgcgggagatcgaatcttatgacgcggtactggtcttg
ggtgaggatgtcactcagaccggcgcgcgcgttgcgctggcggtacgccaggcggtgaaa
ggtaaagcgcgtgaaatggcggcggcgcagaaagtggccgactggcagattgcggccatc
cttaacatcggccagcgtgccaaacatccgctgttcgtgaccaacgtggatgacacccgt
ctggatgatatcgccgcctggacctatcgcgcgccggtggaagatcaggcgcgcctgggc
tttgcgattgctcatgcgctggacaatacagcgcctgcggttgacggtatcgacagcgac
ttacaaaacaaaattgatgtcattgtgcaggcgttggccggcgcgaaaaaaccgctgatt
atctccggcactaacgccggtagcagtgaggtgattcaggcggccgccaacgtggcgaaa
gcgctgaaaggccgtggcgccgacgtcggtattactatgattgcccgctccgtgaacagc
atggggctgggtatgatgggcggcggttcgcttgatgatgcgttgggcgagctggaaacc
ggcagcgcggacgccgtggtggtgctggaaaacgatctccaccgtcatgcaagcgctacg
cgcgtgaacgctgcgctcgccaaagcgccgctggtgatggtggttgaccatcagcgcacg
gcgattatggaaaacgcgcatctggtgctttccgcggcaagcttcgccgaaagcgatggt
acggtcatcaacaacgaaggccgcgcgcagcgcttcttccaggtttatgatccggcctac
tacgataacaagacgattatgctggaaagctggcgctggctgcattcactgcacagcacc
gtcgaaaaccgcgaagtggactggactcagcttgaccacgtgatcgacgcggtcattgcc
gccatgccgcaatttgccggcattaaggacgccgcgccggatgcgaccttccgcattcgt
gggcagaagctggcgcgcgaaccgcatcgttacagcggtcgtacggcgatgcgcgccaat
atcagcgtgcatgaaccacgtcagccgcaggataaagacaccatgttcgccttctcaatg
gaagggaataaccaaccgactgccccgcgatctgaaattccgttcgcctgggcgccgggc
tggaactccccgcaggcgtggaacaaattccaggatgaagtgggcggcaaactgcgtcac
ggcgatccgggcgtgcgtttgattgaagcgactgagggcggtctggattatttcactacc
gtgccggcaagcttccaggcgcaggacggtcagtggcgtattgcgccgtattaccacctg
tttggcagcgacgaattgtctcagcgttctccggtcttccagagccgtatgccgcagccg
tatatcaaacttaacccggcggatgccgcgaagttgggcgtcaatgccgggacgcgcgtc
tcctttagctacgatggcaatacggtgacgctgccggttgaaatctctgaagggttagcg
gcagggcaggtagggctgccgatgggtatgcctggcatcgcgccggttctggctggcgcg
cgtcttgaggatctgcgggaggcgcaacaatga

DBGET integrated database retrieval system