KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2325Help
Entry
STM2325           CDS       T00065                                 

Gene name
nuoE
Definition
(RefSeq) NADH-quinone oxidoreductase subunit E
  KO
K00334  NADH-quinone oxidoreductase subunit E [EC:1.6.5.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00190  Oxidative phosphorylation
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STM2325 (nuoE)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     STM2325 (nuoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2Fe-2S_thioredx
Motif
Other DBs
NCBI-GeneID: 1253847
NCBI-ProteinID: NP_461267
UniProt: P0A1Y8
Position
complement(2435984..2436484)
Genome map
AA seq 166 aa AA seqDB search
MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIAD
VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQT
TFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLERYK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagaatcaacaaccacaaaccgaggcttttgagctgagtgcggcagagcgtgaa
gcgatagagcacgagaagcaccactacgaagacccgcgtgcggcgtccattgaagcgctg
aaaattgttcagaagcagcgtggctgggtgccggacggcgcgatctacgctattgccgat
gtgctgggtattccggcgagcgacgtcgaaggcgtcgccacattctacagccagatcttc
cgtcagccggtcggtcgccacgtgattcgctactgcgacagcgtggtgtgccatatcacc
ggctatcaggggattcaggccgcgctggaaaaaaatctcaacatcaaaccggggcagacg
acctttgatggtcgctttacgctgctgccgacctgctgcctggggaattgcgataaaggg
ccgaacatgatgattgatgaggatactcacagccatctgaccccggaagccattcctgaa
ctactggagcggtataaatga

DBGET integrated database retrieval system