KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2334Help
Entry
STM2334           CDS       T00065                                 

Gene name
yfbT
Definition
(RefSeq) putative phosphatase
  KO
K19270  sugar-phosphatase [EC:3.1.3.23]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STM2334 (yfbT)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.23  sugar-phosphatase
     STM2334 (yfbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 1253856
NCBI-ProteinID: NP_461276
UniProt: Q8ZND8
Position
complement(2445896..2446573)
Genome map
AA seq 225 aa AA seqDB search
MPEEARVQCKGFLFDLDGTLVDSLPAVERAWCSWADRFNLAHDEVLGFIHGKQAITSLRH
FMAGKSEAEIAAEFTRLEQIEATETAGITALPGAVDLLNHLNKVGIPWAIVTSGSMPVAR
ARHQVAGLPAPEVFVTAERVKRGKPEPDAYLLGAQLLGLAPQECVVVEDAPAGVLSGLAA
GCHVIAVNAPADTPRLADVDFALDSLTQLSVAKQPNGDVVVLRKT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaggctcgcgtgcagtgtaaaggttttctgtttgatctggatggaacgttg
gttgactcattacctgccgttgaacgcgcgtggtgtagctgggccgatcgttttaacctt
gctcatgatgaggtgctgggctttattcatggcaaacaggcgatcacctcgttgcggcat
tttatggcgggtaaatcggaggcggaaattgccgctgagtttacgcgcctggagcaaata
gaagccactgaaaccgcagggatcaccgcgctgccgggggcagtcgatttactcaatcac
ctgaataaagtgggcattccgtgggctatcgtcacctccggttcaatgccggtcgcgcgt
gcgcgccatcaggtcgcgggccttccagcgccagaggtgtttgtcaccgccgaacgagtc
aaacgcggcaaaccggagccggatgcgtatttgctgggcgcacaactgcttggcctggcc
cctcaggagtgcgtcgtagtagaagatgccccggctggcgtgctgtccgggctggctgcg
ggctgccacgtcattgcggtcaatgcgccggccgacacgccgcgtctggcggatgttgat
tttgcgttggatagcctgacgcaattatcggtcgctaaacaaccaaacggcgatgtggtg
gtgttaagaaagacctga

DBGET integrated database retrieval system