KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2335Help
Entry
STM2335           CDS       T00065                                 

Gene name
yfbU
Definition
(RefSeq) hypothetical protein
  KO
K09161  uncharacterized protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    STM2335 (yfbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YfbU
Motif
Other DBs
NCBI-GeneID: 1253857
NCBI-ProteinID: NP_461277
UniProt: P60817
Position
complement(2446566..2447060)
Genome map
AA seq 164 aa AA seqDB search
MEMTNAQRLILSNQYKMMTMLDPTNAERYRRLQTIIERGYGLQMRELDREFGELTEETCR
TIIDIMEMYHALHVSWTNLKDTQAIDERRVTFLGFDAATEARYLGYVRFMVNIEGRYTHF
DAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaccaacgcgcaacgtctgattttgtctaaccagtacaaaatgatgacgatg
ctcgatcccaccaacgccgagcgttaccgtcgcttacaaacaattattgaacgcggctac
ggcctgcagatgcgcgagctggatcgcgagtttggcgagctgacggaagagacctgtcgt
accatcatcgatattatggagatgtaccatgcgctgcacgtctcctggaccaacctcaaa
gatacgcaagccatcgacgaacgtcgcgtcaccttcctggggtttgacgccgcgacagaa
gcgcgctacctcggctatgtccgttttatggtgaatatagaaggacgctacactcacttt
gacgccgggacacacggctttaatgcccagacgccgatgtgggaaaaataccagcggatg
ttgaatgtctggcatgcctgcccgcgtcagtaccacctgagcgcgaatgaaatcaatcaa
atcattaatgcctga

DBGET integrated database retrieval system