KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2360Help
Entry
STM2360           CDS       T00065                                 

Definition
(RefSeq) putative diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00300  Lysine biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01230  Biosynthesis of amino acids
Module
stm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STM2360
Enzymes [BR:stm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     STM2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 1253882
NCBI-ProteinID: NP_461302
UniProt: Q8ZNC4
Position
complement(2471264..2472661)
Genome map
AA seq 465 aa AA seqDB search
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNI
HEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIV
FNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHA
ELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDES
RRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRT
DVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHF
DWFFYVYNASRMTAAHDAWIKLAGPLCDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAG
AYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcgattatgcagaattacaaccagctacgtgagcaggtaatcaacggcgat
cgccgtttccagcacaaagacggtcatttgtgttttgaaggggtcgatctggacgctctg
gcgcgccagtaccccacgccgttctatgtgttttctgagccggagattattcgtaacatt
catgaaatccagcaggcatttgcggcgcataaaaataccaaaaccttctttgcgtcaaaa
acctgctcggtcatgggggtgttgaaagccattcgtgacgccggaatttgcgcggaggca
aactcacaatatgaggttcgcaagtgcctggagataggctttcgcggcgatcagatcgtc
ttcaacggcgtggtgaaaaagcctgccgatctggaatatgccatcgccaacgatctgtat
cttattaatgttgatagcctgtatgagctggaacatattgatgccatctctcgcaagctg
aagaaagtcgccaatgtttgcgtccgcgtagaaccgaatgttccctcggcgacgcatgcg
gaactggttaccgctttccatgcgaagtcgggtctcgacctggaacaggcggaagaaacc
tgccgccgcattctggcgatgccttatgtgcatttgcgcggcttgcatatgcatgtgggc
gatcaggtgccggagtcagagcctttcgcaaaagcgactaaagtgctggtggatgaatcc
cgtcgcctggaagaggtgcttggtattaaatttgatttgatcaacgtgggcggcggaatt
ccggttccctataaatatgacgacgagaatggcgacccgttaaaagataatatgtatgcc
ggtattaccgcccaggattttgccgatgcggtcattcgcgaagtgcataaatggcgtacc
gatgtggaaatatgtattgaaccgggacgtaaagtgaccgggtcggcggcggttttactt
acggaagtctcctgcgaaaaacgtaaaacaaattacgatcttaacggcaatgtggaatgc
cacgttgaatggaaatttgtcgacgctggttacagcgtactctctgacagccagcatttt
gactggttcttttatgtctataacgcctctcgcatgacggcagcgcacgacgcctggata
aaattagccgggccgctgtgtgatggcggagattatttccacatgggagtgaaaggcgaa
gagtttttactgccgaaggagactcatgttggcgatattgtcgcatttcttgatgccggg
gcatacaccattgaaagtcaaaccgtttataacaaccgtccgcgcacgggcgtggtgatg
atcgataaaaatggtgacacgcgtctgattcgtcgggaagacagttacgaagatatggtc
aagtacgacatttattaa

DBGET integrated database retrieval system