KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2363Help
Entry
STM2363           CDS       T00065                                 

Gene name
cvpA
Definition
(RefSeq) colicin V production protein
  KO
K03558  membrane protein required for colicin V production
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STM2363 (cvpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Colicin_V
Motif
Other DBs
NCBI-GeneID: 1253885
NCBI-ProteinID: NP_461305
UniProt: Q7CQ42
Position
complement(2475890..2476378)
Genome map
AA seq 162 aa AA seqDB search
MVWIDYAIIAVIAFSCLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTGFEDELV
RNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICFGALRGALIVAAILFFL
DTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggtctggattgattacgccattatcgcggtgattgctttttcctgtctggttagcctg
atccgcggctttgttcgtgaagcgttatcgctggtgacgtggggttgtgctttctttgtc
gccagtcactactacacttacctgtctgtctggtttacgggctttgaagacgaactggtt
cgtaatgggattgctatcgcggtactgtttatcgcgacgcttatcgtcggcgctatcgtg
aattttgtgataggtcagctagtagaaaagaccggcctgtcgggaactgaccgggtgttg
gggatctgtttcggcgcactgcgaggcgcgctgattgtcgccgccattctgttcttcctt
gatacctttaccggcttgtcgaaaagcgaagactggagcaaatcgcagctcatcccgcag
ttcagcttcatcatcagatggttctttgactatctgcaaagctcgtcgagtttcttgccc
aggacgtaa

DBGET integrated database retrieval system