KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2364Help
Entry
STM2364           CDS       T00065                                 

Gene name
dedD
Definition
(RefSeq) cell division protein DedD
  KO
K03749  DedD protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STM2364 (dedD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOR
Motif
Other DBs
NCBI-GeneID: 1253886
NCBI-ProteinID: NP_461306
UniProt: Q8ZNC1
Position
complement(2476689..2477363)
Genome map
AA seq 224 aa AA seqDB search
MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVPKPGDRDEPDMMPAAT
QALPTQPPEGAAEEVRAGDAAAPSLDPSRMASNNVELDPIPVETPKPKPVEKPKPQPKPQ
QPVVAASTPTPAPQPVADDKPAPTGKAYVVQLGALKNADKVNEIVGKLRSAGFRVYTSPS
TPVQGKITRILVGPDASKDKMKGSLGELKQISGLSGVVMGYSPN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagtaagtttcagaatcgtttagtcggcacgattgtgttagtcgcgctgggggtt
attgtgcttcccggtctgctggacggacagaaaaagcattatcaggatgaatttgctgcg
attccactggtaccgaagcctggcgaccgcgatgagccggatatgatgcctgccgcaacg
caggcgctgccgacacagccgccggaaggggcggctgaagaggtgcgggcgggagatgcg
gcagcgccgtcgctggacccgtcgcgcatggcgtctaacaatgtcgagcttgatccgata
ccggtggagacgcctaaaccgaagccggttgaaaagccgaagccgcagcctaaaccgcaa
cagccggttgtcgccgcttccacgccgacgcccgcgccgcaaccagtcgccgacgataaa
cctgcgccgaccggcaaagcctatgtcgtacagttgggcgcgctgaaaaacgcggataaa
gtcaacgagatagtcggcaagcttcgttccgccgggttccgggtttatacttccccctca
acgccggtacagggtaaaataacccgtattctcgtcgggccggatgcgtcgaaagataag
atgaaaggatcgcttggcgagctcaagcagatttccgggttaagcggcgtggtgatggga
tatagcccgaactaa

DBGET integrated database retrieval system