KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2365Help
Entry
STM2365           CDS       T00065                                 

Gene name
folC
Definition
(RefSeq) bifunctional tetrahydrofolate synthase/dihydrofolate synthase
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00790  Folate biosynthesis
stm01100  Metabolic pathways
Module
stm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STM2365 (folC)
Enzymes [BR:stm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     STM2365 (folC)
    6.3.2.17  tetrahydrofolate synthase
     STM2365 (folC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C ArgK
Motif
Other DBs
NCBI-GeneID: 1253887
NCBI-ProteinID: NP_461307
UniProt: Q8ZNC0
Position
complement(2477353..2478621)
Genome map
AA seq 422 aa AA seqDB search
MKNKSIPQAASPLASWLSYLENLHSKSIDLGLERVSQVAARLDILKPAPFVFTVAGTNGK
GTTCRTLESVLIAAGYRVGVYSSPHLVRYTERVRVQGKELAESAHTASFAEIEAARGDIS
LTYFEYGTLSALWLFKQANLDVVILEVGLGGRLDATNIVDADVAVITSIALDHTDWLGPD
RESIGREKAGIFRAEKPAIVGEPEMPATIADVAQETGALLRRRGVDWRYEVTATHWAFTD
GDGTLAGLPLPQVPQPNAATALAALRASRLNIDEQAIRDGIAQATLPGRFQIVSESPRVI
FDVAHNPHAAEYLTGRLKMLPKRGRVLAVIGMLHDKDIAGTLAWLKSVVDDWYCAPLEGP
RGATAEQLLEHLGKGNVYDSVAQAWQAAIDAAQPEDTVLVCGSFHTVAHVMEVIDAGRIG
GE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaatctatacctcaagctgcgtcgcccctggcctcgtggctttcttatctg
gaaaacctgcacagcaagagtatcgatttaggccttgagcgcgtaagccaggtggcagcg
cgtctggacatcctcaagcctgcgccgttcgtttttaccgttgcgggaaccaacggcaaa
ggtacgacctgtcgcacgctggagtcggtgttaatcgcggcgggataccgtgtgggcgtc
tatagttcgcctcatctggtacgttacaccgagcgcgtgcgcgtgcaggggaaagaatta
gcggaatccgcgcataccgcatcctttgcggaaatagaagcggcgcgcggcgatatttca
ttgacctattttgaatatggcacgttgtcggcattgtggctgtttaaacaggctaacctt
gacgtggtgattctggaggtcgggttgggcgggcgcctggacgccacgaacattgtggat
gccgatgtagcggtaattaccagcatcgcgcttgaccatactgactggctggggccggat
cgcgaaagtatcggccgcgagaaagccgggatttttcgtgcggaaaaacccgctatcgtc
ggcgaaccggaaatgccggcaaccatcgcggatgtcgcgcaggagaccggcgcgctgttg
cggcgtcgcggcgttgactggcgttatgaggtgacagcgacccactgggcgtttaccgat
ggcgacggcacgcttgccggactgccgttgccgcaggttcctcagccgaatgccgccacc
gctctggccgcgctgcgcgccagcaggttgaatattgacgagcaggcgattcgcgacggt
attgcgcaggctaccttgccgggacgttttcaaatcgtgagtgagtcgccgcgcgttatc
tttgatgtcgcccataatccccacgcggcggaatacctgacgggtcgtctgaaaatgttg
ccgaaacgcgggcgcgtgcttgcggtgattggtatgctgcatgataaagatatcgccggc
acgttagcctggttgaaaagcgtggttgacgactggtattgtgctccgttagaggggccg
cgcggcgcgacggcggaacaacttctggaacatctggggaaagggaatgtctatgatagc
gtcgcgcaggcatggcaggccgctatcgacgcggcgcagccagaagataccgtgctggtg
tgcggatcgttccacaccgtcgcacatgttatggaagtgatagacgcggggagaatcggt
ggcgagtaa

DBGET integrated database retrieval system