KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2366Help
Entry
STM2366           CDS       T00065                                 

Gene name
accD
Definition
(RefSeq) acetyl-CoA carboxylase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00061  Fatty acid biosynthesis
stm00620  Pyruvate metabolism
stm00640  Propanoate metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01200  Carbon metabolism
stm01212  Fatty acid metabolism
Module
stm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STM2366 (accD)
   00640 Propanoate metabolism
    STM2366 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    STM2366 (accD)
Enzymes [BR:stm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     STM2366 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     STM2366 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans DZR Zn_Tnp_IS91 OrfB_Zn_ribbon zf-FPG_IleRS Zn-ribbon_8 Auto_anti-p27
Motif
Other DBs
NCBI-GeneID: 1253888
NCBI-ProteinID: NP_461308
UniProt: Q7CQ41
Position
complement(2478689..2479603)
Genome map
AA seq 304 aa AA seqDB search
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPDAPREGVVVPPAPDQ
ESEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgaattaaaagcaacattactcccacccgcaaggctagcattcct
gaaggggtgtggaccaagtgtgatagctgcggtcaggttttataccgcgctgagctggaa
cgtaatcttgaggtctgtcctaagtgtgaccatcatatgcgcatgtcggcgcgcaatcgc
ctgcatagcctgttagatgaaggttcccttgtggagttgggtagcgagctggagccaaaa
gacgtgctcaagttccgcgactccaaaaaatataaagacagactggcgtccgcgcagaaa
gaaaccggcgagaaagacgcgctggtggtcatgaaagggacgcttcacggtatgccggtt
gtcgccgccgcgtttgaattcgcgttcatgggcggctcaatggggtctgtcgttggcgca
cgcttcgttcgcgccgttgaacaggcgctggaagacaactgtccgttagtgtgtttctct
gcttccggcggcgcgcgtatgcaagaagcgctgatgtcgctgatgcagatggcgaaaacc
tcggcggcgctggctaaaatgcaggaacgtggtctgccctacatttcggtattgaccgat
ccgacaatgggcggcgtttccgccagttttgcgatgctgggcgatctcaacatcgccgag
ccaaaagctctgattggcttcgccggcccgcgcgttatcgaacagaccgttcgcgaaaaa
ctgccgccaggattccagcgcagtgagttcctgatcgaaaaaggcgctattgatatgata
gtccgccgcccggaaatgcgcctgaagctggcgagcattctggcgaagctgatgaatctg
cccgcgccgaacccggacgccccgcgtgaaggcgtggtggtgcctccggcgccggatcag
gagtctgaggcctga

DBGET integrated database retrieval system