KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2373Help
Entry
STM2373           CDS       T00065                                 

Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_Mu_1
Motif
Other DBs
NCBI-GeneID: 1253895
NCBI-ProteinID: NP_461315
UniProt: Q8ZNB7
Position
complement(2485950..2486324)
Genome map
AA seq 124 aa AA seqDB search
MAKEWFTVKECLGLPGFPGSEPAVRERLYKYSEGKEGVRRKRVKSKAEEFHISVFPLYVH
RYLDDSGEEPTPEPISLQEAEPEDIWEMMFRLLTPEQRKQVTGRFKVRGMKAVFPFLFDD
TPPR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaatggttcacggttaaggaatgtcttggcttaccggggtttccgggaagc
gagcctgcggttcgcgaacgtttgtataagtacagcgaagggaaagagggtgtcaggcgt
aagcgtgttaaatcaaaggccgaggagtttcatatatctgttttccctctttatgttcat
cgttatctggacgacagcggagaggaaccgacgccggaacccatttccttacaggaagcg
gagcctgaagatatctgggagatgatgttcaggttactgacgccagaacagcgcaagcag
gtgaccggacggtttaaggtgagagggatgaaagcggtctttccctttctgtttgatgac
acgccgccacgttga

DBGET integrated database retrieval system