KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2380Help
Entry
STM2380           CDS       T00065                                 

Gene name
yfcL
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YfcL
Motif
Other DBs
NCBI-GeneID: 1253902
NCBI-ProteinID: NP_461322
UniProt: Q7CQ35
Position
complement(2492047..2492322)
Genome map
AA seq 91 aa AA seqDB search
MIAEFESRILALIDDMVEHASDDELFASGYLRGHLTLAIAELESGDDHSVEAVYANVSQS
LEKAIGAGELSPRDQALVKAMWDNLFDKAKQ
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggagtttgaatcacgcattctggcattaattgacgatatggtagagcacgcc
agcgacgatgagctttttgccagtggatacctgcgtggccacctgacgttagccattgcc
gagctggagagcggtgatgaccactccgttgaggcggtctatgccaacgttagccaaagt
ctggaaaaagcgatcggcgccggcgaactgtcgccgcgcgatcaggcgttagtcaaagcg
atgtgggacaatttgttcgacaaggcaaaacaataa

DBGET integrated database retrieval system