KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2381Help
Entry
STM2381           CDS       T00065                                 

Gene name
yfcM
Definition
(RefSeq) elongation factor P hydroxylase
  KO
K09906  elongation factor P hydroxylase [EC:1.14.-.-]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     STM2381 (yfcM)
Translation factors [BR:stm03012]
 Prokaryotic Type
  Elongation factors
   STM2381 (yfcM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EpmC DUF504
Motif
Other DBs
NCBI-GeneID: 1253903
NCBI-ProteinID: NP_461323
UniProt: Q8ZNB1
Position
complement(2492355..2492903)
Genome map
AA seq 182 aa AA seqDB search
MNNTHHYEQLIEIFNGCFAEEFNTRLIKGDDEPIYLPADAQVPYHRIVFAHGFYASALHE
ISHWCIAGKARRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQAFDWLFCVAAGYPFNVSC
DNLEGDIEPDRVAFQRRVHAQVMAYLEQGIPERPARFIKALQNYYHTPELKAEQFPWPEA
LN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacgcaccattacgaacagttaattgagatttttaacggctgctttgccgaa
gaatttaatacccgtctgattaaaggcgacgacgaaccgatctatcttcctgctgacgcg
caggtaccgtaccaccgtatcgtctttgcgcatgggttttacgccagcgcgctgcatgag
atttctcactggtgtatcgccggtaaggcgcgccgcgaactggttgactttggttactgg
tactgcccggacggacgcgacgcgcagacccaaagtcaattcgaagacgttgaggtgaag
ccacaggctttcgactggttgttttgcgtggcggcggggtatccctttaacgtcagttgc
gacaatctggaaggcgatattgaaccggatcgcgtggcgtttcagcgccgggttcatgcg
caggtaatggcgtatctggagcagggcattcctgaacgtccggcccgcttcatcaaagcg
ctacagaattactatcacacgcccgaacttaaggcggaacagttcccgtggccggaagcg
cttaattaa

DBGET integrated database retrieval system