KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2389Help
Entry
STM2389           CDS       T00065                                 

Gene name
yfcY
Definition
(RefSeq) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00071  Fatty acid degradation
stm00280  Valine, leucine and isoleucine degradation
stm00281  Geraniol degradation
stm00362  Benzoate degradation
stm00592  alpha-Linolenic acid metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01212  Fatty acid metabolism
Module
stm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STM2389 (yfcY)
   00592 alpha-Linolenic acid metabolism
    STM2389 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STM2389 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    STM2389 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STM2389 (yfcY)
   00642 Ethylbenzene degradation
    STM2389 (yfcY)
Enzymes [BR:stm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     STM2389 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1253911
NCBI-ProteinID: NP_461331
UniProt: Q8ZNA6
Position
complement(2500251..2501561)
Genome map
AA seq 436 aa AA seqDB search
MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPADAIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKLAEEVMTTYVPPYKNPFAE
DNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAAVILMTESRAKELGLRPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLFDMHEAFAAQTLANLQLLGSE
RFAREVLGCAQATGEVDDAKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggctttaccgttggtcacccgccagggcgatcgcattgctattgtcagtggg
ttacgaacccccttcgctcgtcaggccactgcatttcatggtattcccgctgttgatctc
ggcaagatggtggtaggcgagctgctggcgcgcagtgaaattccagccgatgccattgag
caactggtttttggtcaggtagtacaaatgccggaagcccccaatattgcgcgcgaaatt
gtgctgggtacggggatgaatgttcataccgatgcctatagcgtaagccgcgcctgcgcc
accagttttcaggcggtagcgaatgtggcggaaagcctgatggccggcacgatacgcgcc
ggtatcgctggcggcgcagattcgtcgtcggtactgccaataggcgtgagtaaagccctg
gcgcgggtactggttgatgtcaataaagcccggacgacccgccaacggctgacgcttttt
tctcgtctgcgcttacgcgacctgctgcccgttcctcccgccgttgctgagtattccacc
ggtctgcgcatgggcgataccgccgaacagatggcgaaaacgtatggtattacgcgtgaa
cagcaggacgcgctggcgcatcgttcacatcagcgcgccgcgcaggcatgggcggagggc
aaactggcggaagaagtgatgacgacctatgtgccgccgtataaaaacccctttgcagaa
gacaacaacattcgcggcgcctccacgctggcggactacgctaaactgcgtcccgctttt
gaccgaaaacatggctccgtaaccgccgccaacagtacaccgctgaccgacggcgctgcc
gccgttattctgatgaccgaatcccgcgctaaagagctggggctgcgcccgcttggttat
ctgcgcagctacgcctttaccgctattgatgtctggcaggacatgctattggggccggcc
tggtcaacgccgctggcgctggagcgggccgggttgacgatggccgatctgacgcttttt
gacatgcatgaagcgtttgccgctcagactctggcgaacttacaactgctgggcagcgaa
cgatttgcccgtgaggtgcttggttgtgcgcaggcgacaggggaggtggatgacgctaaa
ttcaacgtgctcggcggctcaatcgcctacgggcatccttttgccgcaacgggcgcgcgg
atgataacccaaacgttgcatgaattacggcgtcggggcggaggttttggcctggtcacg
gcctgcgcggctggcggtcttggcgcggcgatggttctggaggcggaataa

DBGET integrated database retrieval system