KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2392Help
Entry
STM2392           CDS       T00065                                 

Gene name
vacJ
Definition
(RefSeq) phospholipid-binding lipoprotein MlaA
  KO
K04754  phospholipid-binding lipoprotein MlaA
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaA
Motif
Other DBs
NCBI-GeneID: 1253914
NCBI-ProteinID: NP_461334
UniProt: Q7CQ32
Position
complement(2503762..2504517)
Genome map
AA seq 251 aa AA seqDB search
MKLRLSALALGTTLLVGCASSGTEQQGRSDPFEGFNRTMYNFNFNVLDPYVVRPVAVAWR
DYVPQPARNGLSNFTGNLEEPAIMVNYFLQGDPYQGMVHFTRFFLNTLLGMGGFIDVAGM
ANPKLQRVEPHRFGSTLGHYGVGYGPYMQLPFYGSFTLREDGGDMADTLYPVLSWLTWPM
SIGKWTIEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHDFIANGGKLKPQENPNAQA
IQDELKEIDSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcctgtcggcgctggcgctgggaaccacactgctggtcgggtgtgcgagt
tccggtacagaacagcaggggcgttcagacccatttgaagggtttaaccgcaccatgtac
aacttcaactttaatgtgctggacccgtatgttgttcggccggtcgcggtcgcctggcgt
gattatgttccacagcctgcgcgtaacggtttaagtaatttcaccggcaacctcgaagaa
ccggcgatcatggtgaactatttcctgcagggcgatccttatcagggtatggtgcatttc
acccgtttcttcctgaataccttattagggatgggcggctttattgacgtcgcgggaatg
gcgaatcctaagctgcagcgcgttgaaccgcatcgctttggcagtacgctgggccattat
ggcgtggggtatgggccttatatgcaacttccgttctacggcagcttcacgctgcgtgaa
gatggcggggatatggcggataccttgtatccggtgctctcgtggttgacctggccaatg
tccataggaaaatggactatcgaagggatagaaacccgcgcgcagttgctggactccgat
ggtttgctgcgccagtcttccgatccttatattatggtgcgcgaggcgtacttccagcgt
catgactttatcgccaatggcggaaaactcaagccgcaggaaaacccgaacgcgcaggcg
attcaggacgaactcaaagagatcgactcggaataa

DBGET integrated database retrieval system