KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2393Help
Entry
STM2393           CDS       T00065                                 

Gene name
yfdC
Definition
(RefSeq) hypothetical protein
  KO
K21990  formate-nitrite transporter family protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    STM2393 (yfdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans
Motif
Other DBs
NCBI-GeneID: 1253915
NCBI-ProteinID: NP_461335
UniProt: Q8ZNA4
Position
2504806..2505747
Genome map
AA seq 313 aa AA seqDB search
MDSLNDDKINRHSSDLEVESEEKQSGKEIEVDEDRLPSRAMAIHEHIRQDGEKEMERDAM
ALLWSAIAAGLSMGASLLAKGIFHVQLESVPGGFLLENLGYTFGFIIVIMARQQLFTENT
VTAVLPVMQNPTLSNVGLLMRLWGVVLLGNLIGTGVAAWAFEYMPIFDEETRDAFVKIGM
EVMKNSPTEMFANAIISGWIIATMVWMFPAAGGAKIVVIILMTWLIALGDTTHIVVGSVE
ILYLVFNGTLPWSDFLWPFALPTLAGNICGGTFIFALMSHAQIRNDMSNKRKEEARLRGE
RLERERKKAEKQR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatagccttaacgacgataaaattaaccggcacagcagtgacctggaagttgaaagc
gaagaaaaacaaagcggtaaagagattgaagtggatgaagatcgtcttccttcccgcgcc
atggcgattcatgaacatattcgccaggatggtgaaaaagagatggaacgcgatgcgatg
gctttgctctggtcagctattgccgcaggactttctatgggggcatcactcctggcgaaa
gggatttttcacgtgcagcttgaaagcgttcccggcggctttttactggaaaatctcggc
tatacctttggttttatcattgtcatcatggcccgccagcaattatttactgaaaacacc
gttaccgccgtattgccggtaatgcaaaatcccactctgagtaacgttggcctgctgatg
cgcttatggggcgtagtcttattgggcaaccttattggcaccggggttgcggcgtgggca
tttgaatatatgcctatatttgatgaagagacccgcgacgcctttgtcaaaattggtatg
gaggtcatgaaaaatagcccaacggagatgtttgccaacgcgattatctctggctggatc
atcgccacaatggtatggatgtttcctgcagcaggcggggcaaaaattgtggtcattatt
ttgatgacctggcttatcgcgctgggcgataccacccatattgtcgtcggttccgttgaa
attttgtatttggttttcaacggcacgctgccctggagcgactttctctggcccttcgcc
cttcccacacttgccggaaatatctgcggcggcacctttattttcgcattaatgagccac
gcgcagatccgcaacgatatgagcaataaacgtaaggaagaagcgaggctacgcggcgag
cgcctggaacgggagcggaaaaaagcggaaaaacagcgctga

DBGET integrated database retrieval system