KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2399Help
Entry
STM2399           CDS       T00065                                 

Gene name
pgtP
Definition
(RefSeq) MFS transporter
  KO
K11382  MFS transporter, OPA family, phosphoglycerate transporter protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STM2399 (pgtP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2399 (pgtP)
Transporters [BR:stm02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    STM2399 (pgtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP LacY_symp
Motif
Other DBs
NCBI-GeneID: 1253921
NCBI-ProteinID: NP_461340
UniProt: P12681
Position
2512129..2513520
Genome map
AA seq 463 aa AA seqDB search
MLTILKTGQSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLD
LSATQIGLLSSCMLIAYGISKGVMSSLADKASPKVFMACGLVLCAIVNVGLGFSSAFWIF
AALVVFNGLFQGMGVGPSFITIANWFPRRERGRVGAFWNISHNVGGGIVAPIVGAAFAIL
GSEHWQSASYIVPACVAVIFALIVLVLGKGSPRKEGLPSLEQMMPEEKVVLKTKNTAKAP
ENMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLPIYLLTVKHFSKEQMSVAFL
FFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCLIGYWKSESLLMVTIFAAIVG
CLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDKLGWYGGFY
LLMGGIVCCILFCYLSHRGALELERQRQNALHNQDSLQLADAQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatattaaaaacagggcaatcggcgcataaagtcccaccggaaaaagtccag
gccacatatggtcgatatcgtatacaggcattgttaagtgtatttctgggatatctcgct
tactatatagtcagaaacaacttcacattatcgacgccttatttaaaagagcaattggat
ctcagcgctacgcaaatcggcctgctgagtagctgtatgcttattgcttacggaatcagt
aaaggcgtaatgagcagtctggcggataaagccagcccaaaagtcttcatggcgtgcggt
ctggtactctgcgcgattgttaacgttgggctgggattcagtagcgcattctggatattt
gccgctctggtggtcttcaatggcctttttcagggcatgggcgtcggcccctcgtttatt
actattgcaaactggttccctcgtcgggagcgcggacgcgtaggcgccttctggaatatc
tcgcataacgttggcggcgggatcgtcgcgcctatcgtcggtgcggcttttgcgatattg
ggcagcgaacactggcaaagcgccagttatatcgttccggcctgcgtcgccgtcattttt
gccttaattgttctggtcttgggaaaaggttcgccgcgcaaagaaggtcttccctccctg
gaacagatgatgccggaagaaaaagtcgtactgaaaacgaagaatacggcaaaagcgccg
gaaaatatgagcgcatggcaaatcttctgtacttatgtgctgcgcaataaaaatgcctgg
tatatttcgctggtggatgtcttcgtctatatggtgcggtttggcatgattagctggttg
cctatctatctgttgacagtaaaacacttttcaaaagaacagatgagcgtcgcgtttctc
tttttcgagtgggcggcgattccctccacgctactggcaggctggctgtcagataaactg
tttaagggccgcagaatgccgttagccatgatttgcatggcgctgatttttgtctgtctg
atcggatactggaaaagtgaatctttgctgatggtaacgattttcgccgccattgtaggt
tgtctgatttacgtcccgcagttcctcgcgtccgtacagacaatggaaatagtccccagc
tttgccgtaggttccgccgtcggtttacgtgggttcatgagctatattttcggcgcctcg
ttgggcaccagcctgtttggtgtaatggtggataaacttggctggtacggcggattttat
cttctgatgggcggcatcgtgtgctgcattctattctgttacctctcccatcgcggcgcg
ctggaactggaacgccagcgccagaatgcgttacataatcaggactcactgcagcttgcg
gacgcgcaataa

DBGET integrated database retrieval system