KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2404Help
Entry
STM2404           CDS       T00065                                 

Definition
(RefSeq) ion channel protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC DUF3329
Motif
Other DBs
NCBI-GeneID: 1253926
NCBI-ProteinID: NP_461345
UniProt: Q93IM6
Position
2519132..2520367
Genome map
AA seq 411 aa AA seqDB search
MFHPRARTMLLLSLPALIIGVASSLVLIAAMKVASVFQQFLWQRLPTSIGIAYDSPFWIV
GMLTLTGIVVGLIIRYSPGHAGPDPAIEPLISMPVSPSALPGLLLALIIGLAGGVSLGPE
HPIMTINIALAAAFGSRLFPRITALDWTILASAGTIGALFGTPVAAALIFSQTLSGSNDI
PMWDRLFAPLMAAAAGSLTTSLFFHPHFSLPIAHYTQMRLVDIASGAIVAAIAIAAGMVA
VWCLPRLHELLHRLKNPVLILGIGGFILGILGVIGGPLTLFKGLDEMQQMAFSQTLGAGD
YFTLAVVKLAALVIAAASGFRGGRIFPAVFIGAALGLMLHAHVEAVPAAITVSCAILGLV
LVVTRDGWLSLFMAAVVVPDTNLLPLLCIVMLPAWLLLAGKPLLAANRHEP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttccacccgcgtgcccgaacgatgctgctgctgtcgctccccgcgctgattattggc
gtagcgtcaagcctggttttaatcgctgcgatgaaagtcgcgtcggtttttcagcaattt
ctttggcaacgactgcccaccagcatcggcatcgcttatgattcgccgttctggatagtg
ggtatgctcacgctaaccgggatcgtggtgggtttgattatccgttacagtcccggacac
gctggccccgatccggccatcgaaccgttaatcagtatgccggtctcgccatctgcgcta
cccgggctgcttctcgccttaatcatcggccttgctggtggggtaagtttggggccagag
catccgataatgacaataaatatcgcgctggcggcggctttcggctcccgcctgtttccg
cgtatcacggcgttagactggacgattctggcctcagcgggcaccatcggcgcgctgttc
ggcacgcccgtcgccgcagcgctgattttttcgcaaacacttagcggctctaacgatatt
cccatgtgggatcgcctgtttgcgccgttaatggcggcagcggcggggtcactcaccacc
agtctgttctttcatccgcatttttcgttacccatcgcccattacacgcagatgcggctg
gtggacattgccagcggagcgatcgtcgcggcgatcgccattgccgccgggatggtcgcc
gtctggtgccttccgcgtctgcatgagttgctgcaccgcctgaaaaatccggtcctgatt
ctcggcattggcggttttatactgggtattctgggcgtcattggcgggccgcttaccctg
tttaaaggcctggacgaaatgcaacaaatggcgtttagccagacgctgggcgcgggagat
tattttaccttagccgtcgtcaaactcgccgcgctggtcatcgcggcggcgagcggcttt
cgcggcgggcgcatttttccggctgtgtttatcggcgcggcgctggggctcatgctccat
gcccatgttgaggccgtacccgcggcgattaccgtctcctgcgcgattcttggcttagtg
ctggtagtgacgcgcgacggctggctcagtctgtttatggcggcagtcgtcgtaccggat
accaatctgctgccgctgctctgcattgtgatgctccccgcctggctattgctggcggga
aaaccgttgctggccgccaaccgtcacgaaccctaa

DBGET integrated database retrieval system