KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2406Help
Entry
STM2406           CDS       T00065                                 

Definition
(RefSeq) L-glyceraldehyde 3-phosphate reductase
  KO
K19265  L-glyceraldehyde 3-phosphate reductase [EC:1.1.1.-]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STM2406
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     STM2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 1253928
NCBI-ProteinID: NP_461347
UniProt: Q8ZNA1
Structure
PDB: 

Position
2522219..2523217
Genome map
AA seq 332 aa AA seqDB search
MIYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENSRALLQRAFDLGITHF
DLANNYGPPPGSAECNFGRILQEDFLPWRDELIISTKAGYTMWDGPYGDWGSRKYLIASL
DQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRHGKALYVGISNYPADLARQAID
ILEDLGTPCLIHQPKYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRYLNGIPED
SRAASGSRFLKPEQITADKLEKVRRLNELAARRGQKLSQMALAWVLRNDNVTSVLIGASK
PSQIEDAVGMLANRRFSAAECAEIDAILEGRF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcagcccgatgagaatcgttatcacacaatggagtatcgtcgctgcggacgc
agcggcgtcaaacttcccgctatttcgctggggttatggcacaacttcggcgatacgaca
cgggtagaaaatagccgggcgctgctgcaacgcgcgttcgatctgggcattacccacttt
gatctcgccaataattatgggccgccgccgggctccgcagaatgcaattttggccgcatt
ctgcaggaagattttttaccgtggcgtgatgaattgatcatctccaccaaagcgggctac
accatgtgggatggcccttatggcgactgggggtcacggaaataccttatcgccagcctc
gatcaaagcctgaaacgtatggggctggagtatgtcgatatcttttatcaccatcgtccc
gatcccgaaacgccgcttaaagagacgatgaaagcgttagatcaccttgtgcgccatggc
aaagcgttgtacgtggggatctctaactatcctgccgatctggccagacaagctatcgat
attctggaggatctcggcacgccttgcctgattcatcagcctaaatattcgctttttgag
cgttgggtagaggacgggctgctggcgctgttgcaggaaaaaggcgtcggtagtattgcc
ttctcgccgctggcgggcgggcagctcactgaccgttatttgaatggtattccggaagat
tcccgcgcggcgagcggaagccgtttccttaaaccagaacagattaccgccgacaaactg
gaaaaagttcgccggttgaatgaactggctgcgcgacggggtcaaaaattgtctcagatg
gcgctcgcctgggtgctgcgtaacgataacgttacctcggtactgattggcgccagcaaa
ccgtcgcaaatcgaagacgccgtgggaatgctggccaatcgccgtttttcagcggcggaa
tgtgcagaaattgacgctattctggagggccggttttag

DBGET integrated database retrieval system