KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2407Help
Entry
STM2407           CDS       T00065                                 

Gene name
ypeC
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2502
Motif
Other DBs
NCBI-GeneID: 1253929
NCBI-ProteinID: NP_461348
UniProt: Q7CQ29
Position
2523331..2523657
Genome map
AA seq 108 aa AA seqDB search
MFRSLILAAALLAFTPLAANAGEITLLPSIKLQIGDRDDYGNYWDGGRWRDRDYWHNHYE
WRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGRGRGHKHHH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtcactgattctggcggcagccttgctggcttttacaccgcttgccgcgaat
gcgggcgaaatcaccctgttgccctcaataaaattacagattggcgatcgcgatgattac
ggtaactactgggacggtggtcgctggcgcgaccgggattactggcacaaccattatgaa
tggcgtaaaaatcgctggtggcgccatgacaacggctatcatcgcggctgggataagcgt
aaagcgtatgaacgcggttatcgggaaggctggcgcgatcgcgacgatcatcgcgggcga
ggccggggtcacaaacatcatcactaa

DBGET integrated database retrieval system