KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2410Help
Entry
STM2410           CDS       T00065                                 

Gene name
yfeA
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 EAL GGDEF
Motif
Other DBs
NCBI-GeneID: 1253932
NCBI-ProteinID: NP_461351
UniProt: Q8ZN99
Position
complement(2526557..2528746)
Genome map
AA seq 729 aa AA seqDB search
MPDKCNVLKNIKIFLLAFCLTVPAILLSRLISPRATIDSSYIFLAWLPLCVMFSVLFLFG
RRGVAPMVGGMMLTNEWNFHLPLPQAMVLLFCQTFPVLLVCAIVRWQLGARWRYGIPNQG
IWLRVFWLGLMTPFGIKISMHLAGHYLAFPVTISTFFGTGTAIFSIVDLLSLISAALIFT
LFFYYPLRMIVSPHYMRIFWRRDVAPYLAKEKRLFTLLWFATLATLLAVLCTPFETKYIA
GYLVPVLFIGFTIGVGKISYPLLNFSWALTALFLLSYNRNFLQGVGSEYSLAFILSVLIS
FSICLLYMARINQRSEWLNRQWHSQALTDPLTQLPNLRALEQFLLQDAGQSVCYLRMENL
EFLSRHYGMQMRVHCEREVFRMLQPLLLEKEKIFHLPGSELLLVLTGPETEARLQYMLNV
LNNRKIYWNNTGLDMEYGASWGTFDGRQETLQPLLGQLSWLAEQSCSHRRVLALTQSIEA
ASGQTTERVLRLQKIRQALERGALVLYAQPIRDAQGKGYDEILTRLRCDDGIMMPNQFIP
LIAQFNLSIRFDMQVMEALLQWLSAHPSAEQGARFSVNLMPLTLLQKETASRIMQLFKRY
GVPPASVIIEITEEQAFSHSEISMHNINQLRKFGLKIAIDDFGTGYANYERLKRLKADII
KIDGCFVKDILTDSLDAMIVKSITDLAKAKSLSVVAEFVETPAQRDLLLQLGVHSLQGYL
IGRPRPLGK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccggataagtgtaacgtattaaaaaatataaaaatattcttactggccttctgcctg
accgttccggctattctgctatctcgtctcatttctccccgcgccacaattgattccagc
tatatctttctggcctggctaccgctctgcgtcatgttttccgtgctgtttttatttggc
cgccgtggcgtcgcgccgatggtaggcggaatgatgttgactaatgaatggaattttcat
ttacctctgccacaggcgatggtgctgctattttgccaaacgtttcccgtgctgctggtt
tgcgctatcgtacgctggcagctgggcgcgcgctggcgctacggaatacccaaccaaggc
atctggctacgcgttttctggttagggttaatgacgccgtttggtataaaaatcagtatg
catctggcggggcactacctggctttcccggtgaccatctctaccttctttggcaccggc
accgctattttctcgattgtcgatttattgagtctgatttctgccgcgcttatttttacc
ctctttttctattatccgctgcggatgatagtcagcccgcactatatgcgtattttctgg
cggagggatgtcgctccttatctcgccaaagaaaaacgcctgtttacgcttctctggttt
gccactctggcgacgctattagcggtgctgtgtacgcctttcgagacaaagtatattgct
ggctatctggtgccagttctgttcattggatttaccatcggcgtggggaaaatcagctat
ccgctgttgaattttagttgggctctcactgcgctattcctgcttagctataaccgcaat
tttctgcagggcgtgggttcagaatattcgctggcatttatcctttcagttctcatttct
tttagtatttgtttgttgtacatggcgcggattaatcagcgtagcgaatggttgaatcga
caatggcactcgcaggcattgaccgatccgttgacgcaactgcctaacctgcgtgcgctg
gagcagtttcttttacaggatgccgggcaaagcgtgtgttatttacgcatggaaaacctg
gaatttctgagccgtcattacggtatgcagatgcgcgtgcattgcgaacgcgaggtgttt
cgcatgttgcagccgctgctgctggaaaaggagaaaattttccatctgccgggcagtgaa
ttattgctggtgctgacaggaccggagacggaagcccgcctgcaatatatgctcaacgtg
cttaataaccgcaaaatttactggaacaataccggtctggacatggaatacggcgcatcg
tggggaacattcgatggtcgccaggaaaccttgcaaccgctgttggggcaattaagctgg
ctggcggagcaatcctgttcgcaccgtcgggtgcttgcactgacccagagtattgaagcc
gcttccgggcagacgacggaacgggtgctgcggttgcagaaaatccgtcaggcgctggag
cgcggcgcgctggttttgtatgcgcaacccattcgcgacgcgcagggaaaagggtatgac
gagattctgacgcggcttcggtgcgacgacggtatcatgatgccgaatcagttcattccg
cttatcgcccagtttaacctgagcatacggtttgatatgcaggtgatggaagcgctcctg
caatggctgtccgcgcatccttcagcggaacagggggcacgtttttcggttaatttgatg
ccgttgacgctgctgcaaaaagagacggcgtcgcgcattatgcagctttttaaacgctat
ggcgtcccgcctgcttcggtcatcatcgaaattactgaagaacaggccttctctcattcc
gaaatcagtatgcacaatatcaatcaactgcgtaagttcggcctaaaaatcgccattgat
gatttcggcaccggttatgcaaactatgaacggctaaaacgcctcaaggcggacatcatt
aaaatcgacggttgttttgtaaaagatattctgacggactccctggatgcgatgattgtg
aaatccatcactgatttagcgaaagcgaaatcgttgagcgtcgtggctgagtttgttgaa
acgcctgcgcagcgcgatctgctattgcagcttggcgtacacagtttgcagggatatctg
attggccgcccgcgcccgttaggcaaataa

DBGET integrated database retrieval system