KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2414Help
Entry
STM2414           CDS       T00065                                 

Gene name
yfeD
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1323 HTH_17 HTH_23 HTH_Crp_2 HTH_3 Crp HTH_Tnp_1_2 YdaS_antitoxin HTH_29 HTH_Tnp_Mu_1 HTH_Tnp_ISL3 HTH_11 Phage_CI_repr Exc HTH_28 HTH_DeoR Sigma70_r4 HTH_26 Sigma70_r4_2 DUF1804 HTH_10 HTH_Tnp_4 TrmB HTH_20 HTH_7
Motif
Other DBs
NCBI-GeneID: 1253936
NCBI-ProteinID: NP_461353
UniProt: Q8ZN98
Position
2529716..2530108
Genome map
AA seq 130 aa AA seqDB search
MKRLRSKMTTEELAECLGVARQTVNRWIREQHWKTEKFPGVKGGRARLIHIDASVREFIL
NIPAFRKLPAFYQAEEAFAEYANAAHSHAYRQIIDAVENMSAQEQEKLALFLSREGIRGF
LTRLGINEAD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattacgcagtaaaatgaccactgaagagctggctgaatgcctcggcgtggcc
agacaaaccgtcaatcgctggatcagagaacaacactggaaaaccgaaaaatttcccggc
gtcaaaggcggacgcgcaagactcatccatattgatgccagcgtgcgggagtttattctc
aatattccggcttttcgcaaactgcctgcgttttatcaggcggaagaggctttcgcagaa
tatgcgaacgcggcgcacagtcatgcttatcgacaaattattgatgccgttgaaaatatg
tctgctcaggaacaggaaaaactggcgctgtttttatcgcgggaaggtattcgcggattt
ctgacgcgtttaggtatcaatgaggcggactaa

DBGET integrated database retrieval system