KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2415Help
Entry
STM2415           CDS       T00065                                 

Gene name
gltX
Definition
(RefSeq) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00860  Porphyrin and chlorophyll metabolism
stm00970  Aminoacyl-tRNA biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
Module
stm_M00121  Heme biosynthesis, glutamate => heme
stm_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
stm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STM2415 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STM2415 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stm01007]
    STM2415 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stm03016]
    STM2415 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:stm02048]
    STM2415 (gltX)
Enzymes [BR:stm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     STM2415 (gltX)
Amino acid related enzymes [BR:stm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   STM2415 (gltX)
Transfer RNA biogenesis [BR:stm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STM2415 (gltX)
 Prokaryotic Type
   Other AARSs
    STM2415 (gltX)
Prokaryotic defense system [BR:stm02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    STM2415 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c HTH_15
Motif
Other DBs
NCBI-GeneID: 1253937
NCBI-ProteinID: NP_461354
UniProt: P0A2K3
Position
complement(2530162..2531577)
Genome map
AA seq 471 aa AA seqDB search
MKIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREDQMAKGEKPR
YDGRCRHSHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFTREEMIKLFSLGAVSKSASAFNT
DKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKLLGERCKTLKEMAQS
CRYFYEDFSEFDADAAKKHLRPVARQPLEVVRDKLSAITDWSAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFIAERESQQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactcgcttcgcgcctagcccgacaggttatctgcacgtcggcggcgcg
cgtactgctctttattcctggcttttcgcacgtcaccacggcggtgagttcgtgctgcgt
attgaagacaccgatcttgagcgttccacgccggaagccattgaagccatcatggatggt
atgaactggctgaacctggaatgggacgaaggcccatatttccagaccaaacgttttgat
cgctataacgcggtgattgacgagatgctggaggcgggaacagcctataaatgctactgc
tctaaagagcgtctggagcaactgcgtgaagatcagatggcgaaaggcgagaagccgcgt
tatgacgggcgttgccgtcacagtcacgaacatcatgccgacgatgagccatgcgtggtg
cgctttgccaacccgcaggacggttccgttatttttgatgatcagatccgtggcccgatc
gaattcagcaatcaggagctggacgatctgatcattcgtcgtaccgacggttccccaacc
tacaacttctgtgtggtggtggacgactgggatatggaaattacccatgtgattcgtggc
gaagaccatatcaacaatactccgcgccagattaacattctgaaagcgttaaacgcgccg
gtgccgatgtacgcgcatgtgtcgatgattaacggcgacgacggtaaaaagctgtctaaa
cgtcacggtgcggtgagcgtgatgcagtatcgcgatgacggttatctgccggaagcgttg
ctgaactatctggtgcgtctgggctggtccagcggcgatcaggaaatcttcactcgcgaa
gagatgatcaagctgttctccctcggtgcggtgagcaagtctgcgagcgcgttcaacacc
gataaactgctgtggctgaaccaccactatatcaatacgctggcgccggaatatgtggcg
acgcatttgcagtggcatatcgagcaggaaaatatcgacacccgtaacggcccgcagctt
gctgaactggtgaagttgctgggcgagcgctgcaaaactctgaaagagatggcgcagagc
tgccgctacttctatgaagacttcagcgagtttgacgccgatgcggcgaaaaaacacctc
cgcccggtggcgcgtcagccgctggaagtggtgcgcgacaagctgtcggcgattacggac
tggtcagcagaaaacgtccaccacgcgattcaggccacggcggatgagctggaagtgggg
atgggtaaagtggggatgccgctgcgtgtggctgtgaccggtgccgggcagtcgcctgcg
ctggatgtcaccgtacatgcgattggtaaaacccgcagcattgagcgcatcaacaaagcg
ctgggctttatcgccgagcgtgaaagtcagcagtaa

DBGET integrated database retrieval system