KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2426Help
Entry
STM2426           CDS       T00065                                 

Definition
(RefSeq) putative cytoplasmic protein
  KO
K09954  uncharacterized protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    STM2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QSregVF_b TFIID-18kDa
Motif
Other DBs
NCBI-GeneID: 1253948
NCBI-ProteinID: NP_461361
UniProt: Q8ZN90
Position
complement(2538780..2539007)
Genome map
AA seq 75 aa AA seqDB search
MPEMEKEQLVEIANTVMPFGKYQGRRLIDLPEEYLLWFARKDQFPAGKLGELMQITLLIK
TEGLTQLVQPLKRPL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagatggaaaaagagcagctggttgaaatcgccaacaccgtgatgccctttggc
aaatatcagggacgtcgattgatcgaccttccggaagagtatttgctgtggtttgcccgt
aaagatcaatttccggcgggtaaactgggggagttgatgcaaatcacgctgctgattaaa
accgaggggctgacgcaactggtacagcccctgaaacgcccgctttaa

DBGET integrated database retrieval system