KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2430Help
Entry
STM2430           CDS       T00065                                 

Gene name
cysK
Definition
(RefSeq) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00270  Cysteine and methionine metabolism
stm00920  Sulfur metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01200  Carbon metabolism
stm01230  Biosynthesis of amino acids
Module
stm_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STM2430 (cysK)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STM2430 (cysK)
Enzymes [BR:stm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     STM2430 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ADH_zinc_N DFP
Motif
Other DBs
NCBI-GeneID: 1253952
NCBI-ProteinID: NP_461365
UniProt: P0A1E3
Structure
PDB: 

Position
2543230..2544201
Genome map
AA seq 323 aa AA seqDB search
MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK
PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM
KGAIQKAEEIVASDPQKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGG
TLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPGNLD
LKLIDKVVGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILP
SSGERYLSTALFADLFTEKELQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttatgaagataactcgctgactatcggtcatacgccgctggttcgactg
aaccgtatcggtaatggacgcattctggcaaaggtggagtcgcgcaacccgagcttcagc
gtcaagtgccgtatcggcgccaacatgatttgggatgccgaaaagcgtggcgtactgaaa
cctggcgtggaactggtggagccgaccagcggcaacaccggtattgcgctggcgtatgtc
gccgccgcgcgcggttacaaactcaccctgaccatgccggaaaccatgagcattgaacgc
cgcaagctactcaaagcattaggcgcgaatctggtgctgaccgaaggggcgaaagggatg
aaaggcgctattcagaaagccgaagaaattgtcgccagcgatccgcaaaaatatctcctg
ctccagcagttcagcaaccctgccaacccggaaatccatgaaaaaaccaccggcccggaa
atctgggaagacaccgatggtcaggtggatgtgtttatctccggcgtcggcactggcggt
acgttaaccggcgtcacgcgttatatcaaagggacgaagggtaaaaccgatcttatcacc
gttgcggtagaacccactgactccccggttattgcccaggcgctggctggtgaagagatc
aaaccaggcccgcataaaattcagggtatcggcgcaggcttcatcccgggcaacctggat
ctgaaactgattgataaagtggttggcatcaccaatgaagaagctatttctaccgcgcgc
cgtctgatggaagaggaaggtattctggcaggaatttcttccggcgccgcggttgctgca
gcgcttaagctgcaggaagatgaaagctttaccaataagaatattgtggttatcctacct
tcatcaggtgagcgttatctgagcaccgcgttgttcgccgatctctttactgagaaagaa
ctgcaacagtga

DBGET integrated database retrieval system