KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2432Help
Entry
STM2432           CDS       T00065                                 

Gene name
ptsI
Definition
(RefSeq) phosphoenolpyruvate--protein phosphotransferase
  KO
K08483  phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    STM2432 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2432 (ptsI)
Enzymes [BR:stm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     STM2432 (ptsI)
Transporters [BR:stm02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    STM2432 (ptsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers HpcH_HpaI CHASE7
Motif
Other DBs
NCBI-GeneID: 1253954
NCBI-ProteinID: NP_461367
UniProt: P0A249
Position
2544891..2546618
Genome map
AA seq 575 aa AA seqDB search
MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLSGRAKASAQLEAIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQATALEELDD
EYLKERAADVRDIGKRLLRNILGLAIIDLSAIQEEVILVAADLTPSETAQLNLQKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTAQVKNGDYLILDAVNNQVYVNPTNDVIEQLR
AVQEQVATEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFL
FMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAV
RIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAF
DESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNT
NFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaggcattttagcatccccgggtatcgctttcggcaaagcactgctgctgaaa
gaagacgaaatcgtcattgaccggaaaaaaatttctgccgacaaggttgatcaggaagtt
gaacgttttctgagcggtcgtgccaaggcatctgcgcaactggaagcgatcaagacaaaa
gctggtgaaacgttcggtgaagaaaaagaagccatctttgaagggcatattatgctgctc
gaagatgaggagctggagcaggaaatcatagccctgattaaagataagcacatgacggct
gacgcagccgcacatgaagttatcgaaggtcaggccactgccctggaagaactggatgac
gaatacctgaaagagcgtgcggctgacgtacgtgatattggtaagcgcctgctgcgcaac
atcctgggtctggccattatcgatctgagcgcgattcaggaagaagttatcctggttgcc
gctgacctgacgccgtcagaaaccgcgcagctgaacctgcagaaagtgctgggcttcatc
accgacgcgggcggacgcacgtctcatacctccatcatggcgcgttctctggaactgccg
gcgatcgtaggtaccggtagcgtcaccgctcaggtgaaaaacggcgattatctgattctg
gatgccgtaaacaaccaggtttacgtcaacccgaccaacgatgttattgagcaactgcgc
gccgtccaggagcaggttgcgaccgagaaagcggaactggctaaactgaaagatctgccg
gcaatcacgctggatggacatcaggttgaagtttgcgccaacatcggtaccgttcgtgac
gttgaaggcgctgagcgcaacggcgcggaaggcgttggtctgtatcgtactgaattcctg
ttcatggatcgcgacgcgctgccgacggaagaagagcagtttgccgcctataaagcggtc
gctgaagcgtgcggctcgcaggcggttatcgtccgtaccatggacattggcggcgacaaa
gagctgccgtacatgaacttcccgaaagaagagaacccgttcctgggctggcgcgccgtg
cgtatcgccatggatcgcaaagagatcctgcgtgaccaggttcgcgcgattctgcgtgcc
tccgctttcggtaaattgcgcattatgttcccgatgatcatctctgttgaagaagttcgc
gcgctgcgcaaagagattgaaatctacaaacaggaactgcgtgacgaaggtaaagcattt
gacgaaagcattgagattggcgtgatggtggaaacaccggctgcggcgacaattgcgcgt
catttagccaaagaagttgatttctttagtatcggcaccaatgatttaacgcagtacacc
ctggcagttgaccgtggtaatgatatgatttcacacctttaccagccaatgtcaccgtcc
gtactgaacttgatcaagcaagttattgatgcttctcatgcagaaggtaaatggactggc
atgtgtggtgagcttgcaggcgacgaacgtgctacacttctgttgctggggatgggtctg
gacgaattctctatgagcgccatttctatcccgcgcattaagaagattatccgtaacacg
aacttcgaagatgcgaaggtgttagcagagcaggctcttgctcaaccgacaacggacgag
ttaatgacgctggttaacaagttcattgaagaaaaaacaatctgctaa

DBGET integrated database retrieval system