KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2438Help
Entry
STM2438           CDS       T00065                                 

Gene name
yfeK
Definition
(RefSeq) putative periplasmic protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5329 MtrH Med9 S6PP_C
Motif
Other DBs
NCBI-GeneID: 1253960
NCBI-ProteinID: NP_461373
UniProt: P40195
Position
2550587..2550967
Genome map
AA seq 126 aa AA seqDB search
MKKDFTMKKIVCAVVALLLTLPAWAKLNAHEEARINAMLNALAQKKDLTFVRNGDAHNCE
EAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKIPGKSDENAQPYLHALIAE
TDKNVE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggattttaccatgaagaaaattgtttgcgccgtcgttgcgctcctgctgacc
ctacccgcctgggcgaagctgaacgcccatgaagaagcgcgcattaacgccatgcttaat
gcgctggcgcagaaaaaggatctgacattcgttcgtaacggtgatgcgcataactgcgag
gaagccgtatcgcacctgcgcttaaaactgggtaacacgcgcaatcgtatcgacaccgcc
gaacagtttatcgataaagtcgcgtcgtcgtcgtccatcaccggaaaaccctatatcgtt
aaaattcccggtaaaagcgatgaaaacgcgcagccttatttacatgcgcttattgcggaa
acggataagaatgttgagtaa

DBGET integrated database retrieval system