KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2439Help
Entry
STM2439           CDS       T00065                                 

Gene name
yfeL
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly
Motif
Other DBs
NCBI-GeneID: 1253961
NCBI-ProteinID: NP_461374
UniProt: P40196
Position
2550980..2551519
Genome map
AA seq 179 aa AA seqDB search
MPGVLLWFFKGVIALLLAFAVGLIVYYYLEIRPIAQTALQSASFWLSESPQTRFLRRAAA
KIHPKSYTARLLYTQAGVDGHFRIAIWVFWLDSLYRDDELYAMMLAQAYYGRDSQGNAVY
GTKNAALTLFHVPVTEMACQQQVQLIYMFKAPSLYRPGSARLVESSKHYMTLCQEQIQQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgtgttactgtggttttttaaaggcgttatcgcgcttctgttagcgtttgct
gtagggttaatcgtttactattatctggaaattcgtcccatagcccagaccgcattacag
agcgcctctttctggttgtccgaatcgccgcagacgcgttttttgcgccgcgctgcggcc
aaaatacatcccaaatcttatactgccagattgctctatacccaagctggcgtggatggg
catttcaggatcgcgatctgggtgttctggttggacagcctgtaccgcgacgacgagctg
tatgccatgatgctggcgcaagcgtattatggccgggattcgcagggtaacgcggtttac
ggtacgaaaaatgcggcgttaacgttatttcacgtaccagtgacagagatggcctgccag
caacaagtacaactgatttatatgtttaaagcgccgtcactttaccggcctggttcagcc
aggctggtagaaagcagcaagcattacatgacgctttgccaggaacaaatacaacaataa

DBGET integrated database retrieval system