KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2441Help
Entry
STM2441           CDS       T00065                                 

Gene name
cysA
Definition
(RefSeq) sulfate ABC transporter ATP-binding protein
  KO
K02045  sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00920  Sulfur metabolism
stm02010  ABC transporters
Module
stm_M00185  Sulfate transport system
stm_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STM2441 (cysA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2441 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2441 (cysA)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.25  sulfate-transporting ATPase
     STM2441 (cysA)
Transporters [BR:stm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    STM2441 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N TOBE_3 AAA_16 NACHT RsgA_GTPase AAA DLIC AAA_22 AAA_24 AAA_29 AAA_28 SbcCD_C AAA_30 AAA_18 AAA_23 TniB NTPase_1 AAA_25 AAA_33 SRP54 TsaE AAA_14 AAA_5 NB-ARC cobW RecA
Motif
Other DBs
NCBI-GeneID: 1253963
NCBI-ProteinID: NP_461376
UniProt: P40860
Position
complement(2552629..2553726)
Genome map
AA seq 365 aa AA seqDB search
MSIEIARIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQSSGHIR
FHGTDVSRLHARERKVGFVFQHYALFRHMTVFDNIAFGLTVLPRRDRPTAAAIKTKVTQL
LEMVQLAHLADRFPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLR
QLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDRVWREPATRFVLEFMGEV
NRLTGTVRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVDISRRTSLDSPLPVQVIEAS
PKGHYTQLVVQPLGWYHDPLTVVMAGEDVPVRGERLFVGLQKARLYNGDQRIETREEELA
LAQSA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgagatcgccagaattaagaaatcctttggtcgcactcaggtactgaatgat
atctcgctggatattccttccggccagatggttgccttgttggggccgtcaggttccggc
aaaacgacgctgctgcgcattattgccgggctggagcatcagtccagcggtcatattcgt
ttccacggtacggacgttagccgcctgcacgcgcgtgagcgtaaagtcggttttgtgttt
cagcactatgcgctgtttcgccatatgacggtgtttgacaacatcgcttttggcctgacg
gtgctgccgcgacgcgaccgcccaactgcggcggcgattaaaacgaaagtgacgcaattg
ctggagatggtgcaactggcgcacctcgcggatcgcttccccgcccagctttccggcgga
caaaaacagcgcgtggcgctggcgcgcgcgcttgccgtggaaccgcaaattctactgctg
gatgaaccctttggcgcgctggatgcccaggtacgtaaagagttacgtcgctggttgcgc
cagctacatgaagaactgaaattcaccagcgtctttgtcacccacgatcaggaagaggcg
acggaagtggcggatcgggtggtggtgatgagtcagggcaatatcgaacaggctgatgcg
ccggatcgggtgtggcgtgaaccggcaacccgcttcgtactggagtttatgggcgaggtg
aaccgcctgacaggcaccgtccgcggcgggcagtttcacgttggcgcgcatcgctggccg
ctgggttatacgcccgcgtaccaggggccggtcgatctgttcctgcgtccgtgggaggtg
gatattagccgccgcaccagcctggattctcctctaccagtacaggtcattgaggccagc
ccgaaaggtcactatacacagttagtggtacagccgctggggtggtatcacgatccgctg
acggtggtgatggcgggtgaggatgttccggttcgcggcgagcgtttgtttgttggactg
caaaaagcgcgtctgtataacggcgaccagcgtattgaaacgcgtgaagaggaacttgct
ctggcgcaatcggcctga

DBGET integrated database retrieval system