KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2442Help
Entry
STM2442           CDS       T00065                                 

Gene name
cysW
Definition
(RefSeq) sulfate ABC transporter permease subunit CysW
  KO
K02047  sulfate transport system permease protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00920  Sulfur metabolism
stm02010  ABC transporters
Module
stm_M00185  Sulfate transport system
stm_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    STM2442 (cysW)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    STM2442 (cysW)
Transporters [BR:stm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    STM2442 (cysW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4013 ABC_membrane_2
Motif
Other DBs
NCBI-GeneID: 1253964
NCBI-ProteinID: NP_461377
UniProt: Q8ZN87
Position
complement(2553716..2554591)
Genome map
AA seq 291 aa AA seqDB search
MAEVTQLKRYDVPRINWGKWFLIGVGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP
DMLHAIWLTVLIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV
YLLFYGSNGPLGGWLDEHNLQMMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA
ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE
LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEENHEH
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtgactcaattgaagcgatacgacgtcccccgcattaactggggaaaatgg
tttctgattggcgtcgggatgctggtttcggcgtttatcctgctggtgccgatgatttac
atcttcgtgcaggcgttcagcaaagggttaatgccggtactgcaaaatctggccgatccg
gacatgctgcacgccatctggctgacggtgttgattgccttgatcgcagtgccggtgaat
ctggtgttcggcattctgctggcgtggctggtgacgcgctttaacttccccggacgtcag
ctactgctgaccctgctggatattccctttgccgtctcgccggtggtggccggtctggtt
tatctgctgttttatggttccaacggcccgttgggcggctggctggatgagcataatttg
caaatgatgttctcctggccggggatggtactggtcactatttttgtcacctgcccgttt
gtggtgcgcgaactggtgccagtgatgctcagccagggcagtcaggaagatgaggcggcg
attttactgggcgcatccggctggcaaatgtttcgccgcgtgacgttgccgaatattcgc
tgggcgctactctacggcgtggtgttaaccaacgcccgcgcgattggcgagtttggcgcg
gtgtcggtggtgtccggctcgattcgcggcgaaacgttatcgctaccgttacagattgaa
ttactggagcaggactacaacaccgtcggctcctttaccgccgccgcattgttgacgcta
atggcgattattaccctgtttttgaagagcatgttgcaatggcgtctggagaatcaggaa
aaacgcgcgcaacaggaggaaaatcatgagcattga

DBGET integrated database retrieval system