KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2443Help
Entry
STM2443           CDS       T00065                                 

Gene name
cysU
Definition
(RefSeq) sulfate ABC transporter permease subunit CysT
  KO
K02046  sulfate transport system permease protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00920  Sulfur metabolism
stm02010  ABC transporters
Module
stm_M00185  Sulfate transport system
stm_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    STM2443 (cysU)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2443 (cysU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2443 (cysU)
Transporters [BR:stm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    STM2443 (cysU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 FeoB_C Fumarate_red_C
Motif
Other DBs
NCBI-GeneID: 1253965
NCBI-ProteinID: NP_461378
UniProt: P41032
Position
complement(2554591..2555424)
Genome map
AA seq 277 aa AA seqDB search
MLAVSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWAQYWDVVTNPQVVAAY
KVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFS
VNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAQTLGAT
RLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEF
DYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccgtttcttcccgacgcgtgctgcccggctttacgttaagcctcggcaccagt
ttgctgtttgtctgcctgatcctactgttgccgttgagcgcgctggtgatgcagctctca
cagatgagctgggcgcaatactgggatgtcgtgaccaaccctcaggtggtggctgcctat
aaagtgacgctactggcggcatttgtagcgtcgatttttaatggcgtgtttggcctgctg
atggcgtggattttaacccgctaccgttttccagggcgcacgttgctggatgcgctgatg
gatctgccgtttgcgctgccgacagcggtagcggggttaacgctggcctcgctgttctca
gtgaacggtttctacggtcagtttcttgcgcagtttgatatcaaagtgacctatacctgg
ctcggtattgcggtggcgatggcctttaccagtattccatttgtggtgcgcaccgtccag
ccggtactggaagagctggggccggaatatgaagaagcggcgcaaacgctgggggccacc
cggctgcaaagttttcgcaaagtcgtgctgcctgagctgtcgcctgcgctgattgccggc
gtggcgctctcttttacccgtagcctgggcgagtttggcgcggtgatttttatcgccgga
aatatcgcctggaaaacagaagtgacctcgctgatgatttttgtgcgcttgcaggagttt
gattacccggccgctagcgccattgcctcggtgatccttgcggcatccttgctgctgctg
ttctctatcaataccttgcaaagtcgctttggtcgacgtgtggtaggtcattaa

DBGET integrated database retrieval system