KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2451Help
Entry
STM2451           CDS       T00065                                 

Gene name
hemF
Definition
(RefSeq) coproporphyrinogen III oxidase
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00860  Porphyrin and chlorophyll metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
Module
stm_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STM2451 (hemF)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     STM2451 (hemF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coprogen_oxidas
Motif
Other DBs
NCBI-GeneID: 1253973
NCBI-ProteinID: NP_461386
UniProt: P33771
Position
2561204..2562103
Genome map
AA seq 299 aa AA seqDB search
MKPDAHHVKQFLLRLQDDICQTLSAVDGANFVEDSWRREAGGGGRSRVLRNGGIFEQAGV
NFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPHNPYIPTSHANVRFFIAEKPGAD
PVWWFGGGFDLTPYYGFEEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQR
GVGGLFFDDLNTPDFDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRY
VEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDWQPEAGSPEAALSEFIQVRDWI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgatgcacatcacgtaaaacagtttctgctacgcctgcaggatgatatttgc
caaacgttatccgctgtggatggcgcaaactttgtcgaagatagctggcgacgcgaagcg
ggcggcggcggacgcagccgggtattacgcaacggcgggattttcgaacaggcgggcgtt
aatttctctcacgttcacggcgatgcaatgcccgcgtccgccaccgcgcatcggccagaa
ctcgccgggcgtagcttcgaagcgatgggcgtatcgctggtggtgcatccgcacaatccg
tatattcccaccagccatgctaacgtgcgcttttttattgccgaaaaaccgggcgccgat
ccggtatggtggtttggcggcgggttcgatttaacgccctactacggctttgaagaggat
gccgttcactggcaccgcaccgcccgcgacctgtgccagccgtttggtgacgatgtgtat
ccgcgttataaaaagtggtgcgacgactacttttttctcaaacaccgcaacgagcagcgc
ggcgttggcggcctgttttttgacgatttgaatacgccggatttcgaccactgcttcgac
tttatgcaggcggtcggcaacggttacacccgggcgtatttaccgattgtcgaacgacgc
aaagcgatggtctggggcgagcgggagcgtaattttcaactttatcgccgcggtcgctac
gtggagttcaatctggtgtgggacagaggcaccctgtttggtctgcaaaccggcgggcgc
actgaatctatcctgatgtcgatgccgccgctggtgcgctgggagtacgactggcagcca
gaagcgggtagcccggaagcggcgctgagcgagtttattcaggtacgcgactggatttaa

DBGET integrated database retrieval system