KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2452Help
Entry
STM2452           CDS       T00065                                 

Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2142 Claudin_2
Motif
Other DBs
NCBI-GeneID: 1253974
NCBI-ProteinID: NP_461387
UniProt: Q9ZFU5
Position
2562124..2562453
Genome map
AA seq 109 aa AA seqDB search
MQTNTRKVVTSDAKWHPHLGISFIGCLLAITLEIYFEERIFIPHSGGVSFGLIVLLVINM
VTIPVVMALIALLCFIIHIPRKSVNCILLCLLSCILTIAGLFIAYPVGR
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaaatacacggaaagtagtaaccagtgacgccaaatggcatccccatctgggt
ataagttttattggctgcctgcttgccattacactagaaatatattttgaagaaagaata
ttcatccctcatagcggaggggtgagcttcggtctgatcgtgcttctggttatcaatatg
gtgaccatccctgtggtcatggccctgatagcattactctgctttattattcatattccg
cgtaaaagcgttaactgtatcttgctatgcctactgtcatgtattttgacgatagccggt
ttgtttatcgcctatccggttggccgttga

DBGET integrated database retrieval system