KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2453Help
Entry
STM2453           CDS       T00065                                 

Definition
(RefSeq) DUF1963 domain-containing protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1963
Motif
Other DBs
NCBI-GeneID: 1253975
NCBI-ProteinID: NP_461388
UniProt: Q9ZFU6
Position
2562582..2563859
Genome map
AA seq 425 aa AA seqDB search
MDERIPCKNPQCSHFILPATAARTEGYCMPCVQARYRQVQEEYIRKNRKTIDAFSGITNP
VEMLKLVHEPREHDPLIEWIPCPIPTDELYKKLSDDESRDMVDYAEELFDSGWQEEAQEI
ALCLAAFTQANLDNFLRQVINEEELELSSPLPFHRAPPDVRDALLQKVETDDENRDGILC
ALAWIGDEVVVEHFNRWRQEPPAWSASLHILPHRYAHQAGWELTENGRRRDLYFTQCTHL
VKQAPEQPAVFRAVAEYGENCPHCSLPLINLFEVAPSAVGLSTQGWPGQIRILTCQCCTA
YNTVFATVDPQGQPRWYEKNALSTLAVENSADWITLPLDVLHPGESRLPLFAAEIFLPTT
FSQLGGHPAWVQDTDYPTCPTCAQTMMFLAQLSYEDIEEEEYAEGMLYGFICPSCQTTAT
SYQQT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgtattccttgtaaaaacccgcaatgctcacacttcatcctgccagcaacg
gctgcccgcacggagggctattgtatgccctgcgtccaggcgcgctatcggcaagtgcag
gaagaatatatccggaaaaacagaaaaacgatcgacgcgttcagtggcattaccaaccct
gttgaaatgcttaaactcgttcatgaaccccgggaacacgatccgttaatcgagtggatt
ccctgccccattccgaccgatgagctttacaaaaagctctccgatgatgaaagccgcgac
atggtcgattatgcagaagaattatttgattccggatggcaggaggaagctcaggaaatt
gcgctgtgcctggcggcatttacccaggccaatctggataatttcctgcgccaggtaata
aatgaagaagaactggagctctcttcacccctaccttttcaccgtgcgccgcctgacgta
cgcgacgcgcttttgcagaaggtggaaaccgatgacgaaaaccgtgacggcattctttgt
gccctggcctggattggcgatgaggttgtcgttgagcattttaaccgctggcgccaggaa
ccacctgcgtggagtgcttcacttcatatcctccctcatcgctatgctcaccaggcggga
tgggagctcactgaaaatggccgcaggcgcgatctttactttacgcaatgtacccatctg
gtaaaacaggcacctgaacagccggccgtttttcgcgccgttgcagaatatggtgaaaac
tgcccacactgttccctgccgctaatcaatctgtttgaggttgcgccgagcgccgtcggc
ctaagcacgcagggttggcccggtcaaattcgtattctgacctgtcagtgttgtacggca
tataacaccgttttcgccaccgtcgatccacaaggccagccgcgatggtacgaaaaaaat
gcgctctcgacgctggcggtggagaattccgctgactggataacgctaccgcttgatgtt
ctgcaccccggggaatcccgtttgccgctattcgctgctgaaatatttttacccaccacc
ttctcacagctcggcggccatcccgcatgggttcaggatacagactatcctacgtgccca
acgtgcgcgcaaacgatgatgtttcttgcgcagctaagctatgaagatatcgaggaagag
gaatatgcggaaggaatgctttacgggtttatctgcccctcctgccaaacaacggcaacg
tcttatcagcaaacataa

DBGET integrated database retrieval system