KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2454Help
Entry
STM2454           CDS       T00065                                 

Gene name
eutR
Definition
(RefSeq) ethanolamine utilization protein EutR
  KO
K04033  AraC family transcriptional regulator, ethanolamine operon transcriptional activator
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:stm03000]
    STM2454 (eutR)
Transcription factors [BR:stm03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    STM2454 (eutR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC HTH_11 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-GeneID: 1253976
NCBI-ProteinID: NP_461389
UniProt: Q9ZFU7
Position
complement(2564059..2565111)
Genome map
AA seq 350 aa AA seqDB search
MKKTRTANLHHLYHEALPEDVKLTPRVEVDNVHQRRTTDVYEHALTITAWQQIYDQLHPG
KFHGEFTEILLDEIQVFREYTGLALRQSCLVWPNSFWFGIPATRGEQGFIGAQGLGSAEI
ATRPGGTEFELSTPDDYTILGVVISEDVISRQATFLHNPERVLHMLRNQLALEVKEQHKA
ALWGFVQQALATFSESPETLHQPAVRKVLSDNLLLAMGTMLEEAKPIHSAESISHQGYRR
LLSRAREYVLENMSEPLTVLDLCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRE
LISPWSQSATVKDAAMQWGFWHLGQFATDYQQLFAEKPSLTLHQRMRQWA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacccgtacagcgaatttgcaccatctttatcatgaagcgttacccgaagac
gttaaacttacgcccagagtcgaggtggacaatgttcatcagcgacggacgacggatgtc
tatgaacatgctctgactatcaccgcctggcagcagatctacgatcagttacacccgggt
aaatttcatggcgagttcacggaaatcctgcttgatgagattcaggtgttccgtgaatac
accggcctggcgctgcgtcagtcgtgtctggtttggccaaactctttctggtttggtatt
ccggcgacgcgcggcgaacagggatttatcggcgcgcaggggctcggcagcgccgagatt
gccacccgaccgggaggcaccgagtttgaactgagcacgccggatgattacaccattctg
ggcgtcgttatctcggaagatgttatttcccgtcaggccacgtttttgcataacccggaa
agggtgctgcatatgctgcgtaaccagctagcgctggaggtaaaagagcagcataaagca
gcgctgtggggctttgtgcagcaggcgctggccaccttcagcgagagtcctgaaactctg
catcaacctgcggtgcgtaaggtcttgagtgataatttattgctggcgatgggcacgatg
ctggaagaggcgaagccgattcatagcgccgaaagcatcagccatcagggatatcgtagg
ctactgtcgcgggcgcgggaatatgtgctggaaaatatgtcggagccgctgacggtgctc
gacttatgtaaccagctacacgtaagccgtcgcacgctgcaaaatgcgtttcacgccatt
ttgggcattggccccaatgcgtggctgaaacgtattcgcttaaacgcagtacgccgggaa
ctgattagcccgtggtcgcagagcgccacggtcaaagatgccgcgatgcagtggggattc
tggcatctggggcaatttgccaccgattatcagcaattatttgccgaaaaaccgtcgttg
acgctgcatcaacggatgcggcaatgggcttga

DBGET integrated database retrieval system