KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2502Help
Entry
STM2502           CDS       T00065                                 

Gene name
ppx
Definition
(RefSeq) exopolyphosphatase
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STM2502 (ppx)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     STM2502 (ppx)
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     STM2502 (ppx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA HD FtsA DUF393
Motif
Other DBs
NCBI-GeneID: 1254024
NCBI-ProteinID: NP_461437
UniProt: P0A269
Position
2617007..2618548
Genome map
AA seq 513 aa AA seqDB search
MPIYDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRVHLADGLGADNKLSEE
AMERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQAQNAADFLKRAEKVIPYPIEIISGNE
EARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPRLVESRRMGCVSFAQLYFPGG
VINKENFQRARMAAAQKLETLTWQYRIQGWNVAMGASGTIKAAHEVLLALGEKDGFITPE
RLDKLKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGVFDALAIRELRLSDGALREG
VLYEMEGRFRHQDVRSRTAKSLANQYNIDREQARRVLETTMQMYEQWQAQQPKLAHPQLE
ALLRWAAMLHEVGLNINHSGLHRHSAYILQHSDLPGFNQEQQMMMATLVRYHRKAIKLDD
MPRFTLFKKKQYLPLIQLLRLGVLLNNQRQATTTPPTLRLTTDDSHWTLCFPHDWFSQNA
LVLLDLEKEQQYWEAVTGWRLNIEEESSPEIAA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccaatttacgataaatcccctcgtccgcaggagttcgctgcggtcgatctcggctca
aacagctttcatatggtcattgcccgcgtggttgacggcgcaatgcagattatcgggcgc
ttaaaacagcgcgtccatctggcggacgggctgggcgcagataacaaactcagcgaagaa
gccatggaacgggggcttagctgtctgtcgctgtttgctgaacgcttacaaggtttctcc
ccttccagcgtctgtatcgtaggcacccatacgttacgtcaggcgcaaaatgccgctgat
tttctcaaacgcgcggaaaaggttattccctacccgatagagattatttccggtaacgaa
gaagcgcgcctgatttttatgggcgtagaacatacgcagccggaaaaaggccgcaagctg
gtgatcgatatcggcggcgggtcaacagagctggtcattggcgaaaacttcgaacccagg
ctggttgaaagccgtcgtatgggctgcgtgagcttcgcgcagctctactttcccggcggc
gttatcaataaagaaaacttccagcgcgcccgaatggcggcggcgcaaaaactggaaacc
ttaacctggcagtatcgtattcagggttggaacgtagcgatgggcgcttccggtacgatt
aaggccgctcatgaagttctcctggcgctgggtgagaaagatggcttcattacgccggag
cgcctcgataaactgaagtcagaagtgttgaagcaccgctcctttaatgcgctcagcctg
ccgggtctgtctgaagaacgaaaagcggtctttgtgccgggcctggcgattctgtgcggc
gtttttgatgctctggctatccgcgagcttcgcctttccgacggcgcattgcgcgaaggc
gtactgtatgaaatggaaggccgcttccgccatcaggatgttcgcagccgtaccgcaaaa
agtctggccaatcaatacaacattgacagagaacaggccagacgcgtgctggaaaccacc
atgcagatgtacgagcagtggcaggcccagcagccaaaactggcgcatccgcagcttgaa
gcgttgcttcgctgggcggcaatgctgcatgaggttggactgaatattaatcacagcggt
ttacatcgccattcggcttatattctgcaacacagcgatttgcccggctttaatcaggag
cagcaaatgatgatggcgacgctggtgcgttaccatcgtaaagccataaaactggatgat
atgccccgctttacgctgtttaagaaaaaacagtatctgccgttaattcagctacttcgg
ctgggcgtattactgaacaaccagcggcaggcgaccaccacgccgccgacgctgcggcta
acgaccgatgacagccactggacgttatgttttccgcatgactggttcagccagaatgcg
ctggtactgcttgatctggaaaaagaacagcagtactgggaagcggtaactggctggcgt
ctcaatattgaggaagaaagctcgccggagatcgccgcgtaa

DBGET integrated database retrieval system