KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2786
Entry
STM2786           CDS       T00065                                 
Name
(RefSeq) tricarboxylic transporter
  KO
K07795  putative tricarboxylic transport membrane protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STM2786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2786
Transporters [BR:stm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   STM2786
SSDB
Motif
Pfam: TctC
Other DBs
NCBI-GeneID: 1254309
NCBI-ProteinID: NP_461712
UniProt: Q9FA46
Position
2934594..2935571
AA seq 325 aa
MKKQLLRTLTASILLMSTSVLAQEAPSRTECIAPAKPGGGFDLTCKLIQVSLLETGAIEK
PMRVTYMPGGVGAVAYNAIVAQRPGEPGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLASV
GTDYGMIAVRADSPWKTLKDLMTAMEKDPNSVVIGAGASIGSQDWMKSALLAQKANVDPH
KMRYVAFEGGGEPVTALMGNHVQVVSGDLSEMVPYLGGDKIRVLAVFSENRLPGQLANIP
TAKEQGYDLVWPIIRGFYVGPKVSDADYQWWVDTFKKLQQTDEFKKQRDLRGLFEFDMTG
QQLDDYVKKQVTDYREQAKAFGLAK
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaaaaacaattacttcgtacccttactgcaagcattttattaatgagtacctctgtt
ctggcgcaggaggcgccgtcgcgaacggaatgtatcgcgccagccaaacctggcggcggt
ttcgacctcacctgtaagctgattcaggtgagtttgctggagactggcgctatcgagaaa
cccatgcgggtaacgtatatgcccggcggcgtcggcgctgtggcctataacgcgatagtc
gcccaacgccctggcgaacccgggactgtggtcgccttttccggcggttcgctgctcaac
ctgtcgcaggggaaatttggtcgctacggcgtggatgatgtgcgctggctggcaagcgtg
ggcactgattacggcatgatcgccgtgcgtgcggattctccgtggaaaacgctgaaagat
ctgatgacggcgatggaaaaagatcccaacagcgtggtcattggcgctggcgcctctatt
ggcagccaggactggatgaagtcggcattgctggcgcaaaaggcgaacgtcgacccgcac
aagatgcgctacgttgcctttgagggcggcggcgagccggtgacggcattaatgggcaac
catgttcaggttgtctccggcgatctcagtgaaatggtgccttatctgggcggcgacaaa
atccgcgtgcttgccgtcttttcagaaaatcgtctgccgggccagcttgccaatatccct
accgctaaagaacagggctacgacctggtgtggccgattattcgcggcttctacgtcggg
cccaaagtcagcgatgccgattaccagtggtgggtggataccttcaagaagctccagcaa
accgacgagtttaaaaagcagcgcgatctgcgcggcctgtttgagttcgacatgaccggc
cagcagctcgatgactacgtgaaaaaacaggttactgattaccgtgaacaggcgaaagcc
ttcggactcgcgaaataa

DBGET integrated database retrieval system