KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2808
Entry
STM2808           CDS       T00065                                 

Gene name
nrdF
Definition
(RefSeq) class 1b ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00230  Purine metabolism
stm00240  Pyrimidine metabolism
stm01100  Metabolic pathways
Module
stm_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STM2808 (nrdF)
   00240 Pyrimidine metabolism
    STM2808 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:stm03400]
    STM2808 (nrdF)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     STM2808 (nrdF)
DNA repair and recombination proteins [BR:stm03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    STM2808 (nrdF)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 1254331
NCBI-ProteinID: NP_461734
UniProt: P17424
Structure
PDB: 
1R2F 2R2F 2BQ1

Position
2954641..2955600
AA seq 319 aa
MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVF
TGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDA
AYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
TADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEAL
YAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGS
GSSYVMGKTVETEDEDWNF
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaaattatctcgtattagcgccatcaactggaacaagatccaggacgacaaagatctg
gaggtatggaaccggctgaccagtaacttctggctgccggaaaaagtgccgttatcgaat
gatattccggcctggcagacgctgagcgccgccgaacagcagctcaccattcgcgtgttt
acgggacttacgctgctcgacactatccagaacatcgcaggcgcgccgtcgttaatggca
gatgccatcacgccgcatgaagaggcagtgctgtcgaacatcagctttatggaagcggta
cacgcccgctcttacagttctattttctccacgctgtgccagacgaaagaggttgatgcc
gcctacgcctggagcgaagaaaacccaccgcttcagcgtaaggcgcagattattttagct
cattacgtcagcgatgaaccgctaaagaaaaagattgccagcgtctttttagagtctttt
ctgttctattccggcttctggttgccgatgtatttctccagccgcggtaagctcacgaac
actgccgacctgattcgtttaatcattcgcgatgaagcggttcacggttattatattggc
tataagtatcagatagcgctacaaaaactatcggcaatcgagcgtgaagagttaaagctt
ttcgcgctggatttgttgatggaactgtacgacaacgaaatccgctacacagaagcgtta
tatgcggaaaccggctgggttaacgacgtcaaagccttcttgtgctacaacgccaataaa
gccttaatgaacctgggttatgaggcgttatttccgccggagatggcagacgtgaatccc
gcaatccttgccgcgctctcgccgaatgccgacgaaaaccatgatttcttttccggctca
ggttcatcttatgtgatggggaaaacagtcgaaaccgaagacgaagactggaatttttaa

DBGET integrated database retrieval system