KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2862
Entry
STM2862           CDS       T00065                                 

Gene name
sitB
Definition
(RefSeq) manganese/iron transporter ATP-binding protein
  KO
K11607  manganese/iron transport system ATP-binding protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2862 (sitB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2862 (sitB)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter
    STM2862 (sitB)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C AAA_29 AAA_33 AAA_23 AAA_15 MMR_HSR1 RsgA_GTPase AAA_17 AAA_22 AAA_30 AAA_18 AAA_10 RBP_receptor
Other DBs
NCBI-GeneID: 1254385
NCBI-ProteinID: NP_461783
UniProt: H9L493
Position
3007289..3008110
AA seq 273 aa
MSQSAITVDQVTVTYRNGHTALRDATFQVPGGSIAALVGVNGSGKSTLFKALMGFVHLAQ
GDITILQQSVNKALKKNLIAYVPQSEEVDWSFPVLVEDVVMMGRYGHMGWLRRPTAHDHA
CVDAALARVDMQEYRHRQIGELSGGQKKRVFLARAIAQDGQVILLDEPFTGVDVKTEARI
IDLLRELRDEGRTMLVSTHNLGSVTEFCDYTVMIKGTVLASGPTETTFTAANLEQAFSGV
LRHIALSGGEEHIITDDERPFISRRVASGGKSS
NT seq 822 nt   +upstreamnt  +downstreamnt
atgagtcaatctgcgattaccgttgatcaagtcacggtgacgtatcgcaacggtcatacc
gccctacgggacgccacttttcaggtgcctggcggttcaatcgccgcgctggtaggcgta
aatggttccggtaagtctacgttatttaaagcgttaatgggctttgtgcatcttgcgcag
ggcgatatcactatcctgcaacagtcagtcaacaaggcactgaaaaaaaacctcattgct
tatgttccgcaatcggaagaagtggactggtcatttccggtgctggtagaagatgtggtg
atgatgggacgctacggccatatgggctggctacgccgtcccactgcgcatgatcacgcc
tgtgttgacgccgcgctggcgcgggtggatatgcaggagtatcgtcacaggcagattggc
gagctgtccggcgggcagaaaaaacgtgtgtttcttgccagggccatcgctcaggatgga
caggtgatcctgctggatgaaccttttaccggcgtggatgtaaaaaccgaagcgcgaatc
atcgatctactgcgggaactgcgcgatgaaggccgcacgatgctggtctcaacgcataat
ctcggctccgtcaccgagttttgcgactatacggtaatgattaaaggaaccgtactggcc
agcggccctaccgaaaccacgtttaccgccgcgaatctggaacaggcgtttagcggcgtt
ctacgtcatatcgcgttaagcggaggtgaagagcacatcatcaccgatgacgagcgcccc
tttatttcccggcgcgtggccagcggaggaaaatcgtcatga

DBGET integrated database retrieval system