KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2863
Entry
STM2863           CDS       T00065                                 

Gene name
sitC
Definition
(RefSeq) iron ABC transporter permease
  KO
K11605  manganese/iron transport system permease protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2863 (sitC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2863 (sitC)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter
    STM2863 (sitC)
SSDB
Motif
Pfam: ABC-3 FecCD
Other DBs
NCBI-GeneID: 1254386
NCBI-ProteinID: NP_461784
UniProt: H9L4A7
Position
3008107..3008967
AA seq 286 aa
MNWLVEPFGYQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAWML
GLPFSLGAFLSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGVGLFMVSLNPMSVNIQT
IILGNVLAIAPADIAQLAIIGAVSLTILLLKWKDLMVVFFDETHARSIGLNPGRLKLLFF
TLLSVSTVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVVIGSLTSFLGAWLSY
WLDGATGGIIVVMQTLLFITAFIFAPKHGLLANRRRARLQKEPTCS
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaactggcttgttgagccgtttggctaccagtatatgctcaacgcgatgtgggtctcc
gcgatggtgggcggtctgtgcgcgtttctctcctgctatttgatgctcaaaggctggtcg
ctcattggcgatgcgctatctcactctattgtgcctggcgtcgctggcgcctggatgtta
gggctgcccttctcgctcggcgcgtttctttccggcggactggcggcaggcagtatgctc
tttcttaaccaacgctcacgcctgaaagaagacgcgattatcgggcttatcttctcctct
ttttttggcgtcggcctttttatggtgtcgctcaatccgatgtcggtgaatatccagacg
attattctcggcaacgtgctggcgatcgcaccagcggatattgcgcaactggcgattatc
ggcgcagtctcgctgacgattctgctgttaaagtggaaagatctgatggtcgtctttttc
gatgaaacccatgcgcgttctatcgggcttaatccgggtcgactaaagctgttgtttttc
actctattgtccgtctctaccgtggcggccctgcaaaccgttggggcgttcctggtgatc
tgtctcgtcgtcacgccgggcgcgacggcctggttactcaccgaccgttttccacgtctg
ctcatgattgccgtcgtgattggcagcctgaccagttttctgggcgcatggcttagctac
tggctggatggcgccacgggtggaattattgtcgtcatgcaaaccttactgttcatcaca
gcctttattttcgccccgaaacacggtctgttagccaaccgtcgacgcgcccgcctgcag
aaggagccgacatgttcttaa

DBGET integrated database retrieval system