KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2864
Entry
STM2864           CDS       T00065                                 

Gene name
sitD
Definition
(RefSeq) iron ABC transporter permease
  KO
K11606  manganese/iron transport system permease protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM2864 (sitD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM2864 (sitD)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter
    STM2864 (sitD)
SSDB
Motif
Pfam: ABC-3 FecCD
Other DBs
NCBI-GeneID: 1254387
NCBI-ProteinID: NP_461785
UniProt: H9L416
Position
3008958..3009806
AA seq 282 aa
MFLTTLLEPFQFDFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAY
IVGIPLAIGAFIAGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQSEVHL
DHILFGDMLGVSLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYG
LLCMIALTIVATLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYL
SFYLDSAPAPTIVVLFAIVFIAAFIYATWRDRRNEIVPEAQG
NT seq 849 nt   +upstreamnt  +downstreamnt
atgttcttaacaacgttactggaaccctttcagtttgattttatggtgaacgcccttatg
gtttcggtcattgtggcgattccctgcgccttactgtccgtgtttttagtgttaaaaggc
tgggcgttaatgggcgatgcaatgagtcatgcggtattccccggggtcgtgctggcatat
attgtggggatccccctggcgattggcgctttcattgccggattattttgcgctatcgcc
accggctatctggacgataacagccgcatcaaacgtgatacggtgatgggcatcgtcttt
tccgggatgtttggcgcaggtctggtgctctatgtttctattcaatcggaagtgcatctg
gatcacatcctgtttggggatatgctgggcgtatcgctgggggatatcgtacaaacgtca
gttattgcactgggtattgcgttaatcatagggctgaaatggaaagatctcctgctacac
gcttttgacccgcaccaggcgaaagccagcgggctgaataccacactactgcattatggc
ctgctatgtatgattgcgctgactatcgtcgccacgctgaaatcggtgggcattattctg
tcaatctcactgcttatcgcccccggcgcaattgccattttgctgacgcgacgctttgcg
cgcgcgctgggattagcggtgagtctgtcagttattaccgcttttgcgggcgtttatctg
tctttttatcttgatagcgcgccagcgccgaccatcgtggtattatttgccatcgtgttt
attgcggcatttatttacgcaacatggcgcgacaggcgtaatgaaatcgtaccagaggcg
caaggttaa

DBGET integrated database retrieval system