KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2951Help
Entry
STM2951           CDS       T00065                                 

Gene name
ygcF
Definition
(RefSeq) 7-carboxy-7-deazaguanine synthase QueE
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00790  Folate biosynthesis
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STM2951 (ygcF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stm03016]
    STM2951 (ygcF)
Enzymes [BR:stm01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     STM2951 (ygcF)
Transfer RNA biogenesis [BR:stm03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    STM2951 (ygcF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_14 Radical_SAM Fer4_12
Motif
Other DBs
NCBI-GeneID: 1254474
NCBI-ProteinID: NP_461872
UniProt: Q7CPW4
Position
complement(3096564..3097235)
Genome map
AA seq 223 aa AA seqDB search
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLSDREVSLFSILAK
TKESDKWGAASSEDLLAVINRQGYTARHVVITGGEPCIHDLMPLTDLLEKSGFSCQIETS
GTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRVRDIEALDELLATLSD
DKPRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNIA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccgattaacgagatgttccagaccctacaaggcgagggttattttaccggc
gtccccgctatttttattcgtttacagggatgtccggtcggctgtgcctggtgtgatact
aagcatacctgggataaactgagcgatcgggaagtgtctctgttcagcattctggcaaaa
accaaagagagcgacaaatggggtgctgcgagcagtgaagacttgctggcagtaattaat
cgtcagggctataccgcgcgtcacgttgtcatcaccggtggcgaaccctgtattcacgac
ctcatgccgctcaccgatctgcttgaaaagagtggttttagttgtcagattgaaaccagc
gggacgcacgaagtgcgctgtacgcctaacacctgggtcacggtttcaccaaaagtgaat
atgcgcgggggatatgacgtgctttcccaggcgctggagcgcgccaatgaaatcaagcat
cccgttgggcgagttcgtgatattgaggcgctggatgaactgttagccacgttgagcgat
gataaaccgcgtgtgattgctttgcagcccattagccagaaagaagacgcgacgcgtctg
tgtattgaaacgtgtattgcacgtaactggaggctgtctatgcaaacgcataaatattta
aatatcgcctga

DBGET integrated database retrieval system