KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2964Help
Entry
STM2964           CDS       T00065                                 

Gene name
yqcB
Definition
(RefSeq) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stm03016]
    STM2964 (yqcB)
Enzymes [BR:stm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     STM2964 (yqcB)
Transfer RNA biogenesis [BR:stm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    STM2964 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 1254487
NCBI-ProteinID: NP_461885
UniProt: Q8ZMD5
Position
complement(3115551..3116333)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLIIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHLT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacaggcccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggccgtaacgcagtatcgcgggctggcgacggtcgaaatggcggtgccg
accgggcgttatcccaccacgcgttatggcctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcgtcttgaactgacgcaccccttcaccggacagccgttgataattcag
gccgggttggatgaaacctggatgcaggcgctgacgcagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatctgaca
taa

DBGET integrated database retrieval system