KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3044
Entry
STM3044           CDS       T00065                                 

Gene name
xerD
Definition
(RefSeq) site-specific tyrosine recombinase XerD
  KO
K04763  integrase/recombinase XerD
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:stm03036]
    STM3044 (xerD)
Chromosome and associated proteins [BR:stm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    STM3044 (xerD)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4
Other DBs
NCBI-GeneID: 1254567
NCBI-ProteinID: NP_461960
UniProt: P0A2P6
Position
complement(3204431..3205327)
AA seq 298 aa
MEQDLARIEQFLDALWLERNLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLA
ERVEGGYKATSSARLLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEAQVER
LLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVP
LGEEAVYWLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEK
LSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaacaggatttagcgcgtattgagcagtttctggatgccctgtggctggaacgaaat
ctggcggaaaatacattaagcgcgtatcgtcgcgatttatcgatggtcgttgcgtggttg
catcatcgcggaaaaacgcttgcgacggcgcaggctgatgatttacaaacgctattggct
gaacgtgtggagggcggatacaaagcgaccagctccgcacgcctgttaagcgctatgcgg
cgctttttccagcatctgtaccgtgaaaagtatcgtgaggatgatccgagcgcgcagttg
gcctcgcctaagcttccgcagcgtttaccgaaagatcttagcgaggcgcaggttgaacgg
ctcttgcaggcgccgcttattgatcaacctttggagctgcgcgataaagctatgttggaa
gtgctgtatgccaccggtttgcgcgtgtcggaactggtggggctgacaatgagcgatatc
agtctgcggcagggcgtggtgcgggttatcggtaaaggcaataaagagcggttggtgccg
ttaggtgaagaggcggtatattggctggaaacgtatctggagcatgggcgtccatggtta
ctcaatggcgtatcgattgacgtattattccccagccagcgtgcgcagcagatgacgcgg
cagaccttctggcaccgtattaaacattatgcggtactggctggaatcgatagcgaaaaa
ctatcgccgcatgttttacgtcacgctttcgccacgcatttgctgaatcacggcgccgac
ttgcgcgttgtacaaatgctacttgggcatagcgatctttcgacgacacaaatttatacg
catgtcgcaacggagcgtttgcgtcaacttcatcaacagcaccatccgcgggcatga

DBGET integrated database retrieval system