KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3103Help
Entry
STM3103           CDS       T00065                                 

Gene name
yggV
Definition
(RefSeq) RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STM3103 (yggV)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     STM3103 (yggV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 1254626
NCBI-ProteinID: NP_462019
UniProt: Q8ZM45
Position
3262535..3263128
Genome map
AA seq 197 aa AA seqDB search
MQKVVLATGNAGKVRELASLLSDFGLDVVAQTELGVDSAEETGLTFIENAILKARHAAKM
TGLPAIADDSGLAVDVLGGAPGIYSARYSGENATDQQNLEKLLHTLRDVPDDKRQARFHC
VLVYLRHAEDPTPIVCHGSWPGVITRQAAGNGGFGYDPIFFVPSEGKTAAELTREEKSAI
SHRGQALKLLLDALRNG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagttgttctcgcaaccggcaacgccggtaaagtgcgcgagctcgcgtcgctg
ttaagcgattttgggcttgatgtggtagcgcaaacggaactgggcgtcgattccgcggaa
gaaaccggcctgacgtttattgaaaacgcgattctcaaagcgcgccatgccgccaaaatg
accggcctgcccgccattgccgatgactccggtctggccgttgacgttttaggcggcgcg
ccgggtatctattccgcgcgctattctggcgaaaacgcgacagatcagcaaaatctggaa
aaactgctgcatactctacgggatgttccggacgacaaacgccaggcgcgattccattgt
gtactggtttatttgcgtcatgcggaagatcccacaccgatagtctgtcacggtagctgg
cctggcgtcattactcgccaggcggccggaaatggcggatttggctatgatcccattttc
ttcgtaccgtctgaaggcaaaaccgccgcagaactgacccgtgaagaaaaaagcgcgatt
tcccaccgtggacaagcgctcaagctgctgctggatgcgttacgcaatggctaa

DBGET integrated database retrieval system