KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3212Help
Entry
STM3212           CDS       T00065                                 

Gene name
mug
Definition
(RefSeq) double-stranded uracil-DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:stm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    STM3212 (mug)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:stm03400]
    STM3212 (mug)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     STM3212 (mug)
DNA repair and recombination proteins [BR:stm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     STM3212 (mug)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 1254735
NCBI-ProteinID: NP_462127
UniProt: Q7CPR7
Position
complement(3378379..3378885)
Genome map
AA seq 168 aa AA seqDB search
MVKDILAPGLRVVFCGINPGLSSANTGFPFAHPANRFWKVIHLAGFTDRQLKPEEAEKLL
DFRCGVTKLVDRPTVQATEVKLHELRSGGRNLIEKIEDYQPAALAVLGKQAFEQGFSQRG
IAWGKQKIAIGATMVWVLPNPSGLNRIKTEKLVEAYRELDQALIMRGL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggacatactggcgccagggctacgggtggttttttgcggcatcaatccggga
ctctcctcggcgaataccggctttccgtttgcgcatcccgcgaatcgtttttggaaagtt
attcatttggccggtttcaccgatcgacagttgaaaccggaagaggcggaaaaattactg
gattttcgctgcggggtaacgaaactcgtcgaccgaccgacggtacaagcgactgaggtg
aagttgcatgaattacgtagcggcggacgaaacctgattgaaaaaatagaggactaccag
cccgcggcgctggcggtgcttggtaaacaggcttttgaacaggggttcagccagcgcggt
atcgcctggggtaaacaaaagatcgccattggcgcgacgatggtgtgggtgttgccgaat
cccagcggcttaaaccgaattaaaacggaaaaactggtcgaggcctatcgcgaactggat
caagcgctcattatgcgtgggctatag

DBGET integrated database retrieval system