KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3249
Entry
STM3249           CDS       T00065                                 

Gene name
garL
Definition
(RefSeq) 2-dehydro-3-deoxyglucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00053  Ascorbate and aldarate metabolism
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    STM3249 (garL)
Enzymes [BR:stm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     STM3249 (garL)
SSDB
Motif
Pfam: HpcH_HpaI PK
Other DBs
NCBI-GeneID: 1254772
NCBI-ProteinID: NP_462162
UniProt: Q7CPQ8
Position
complement(3417376..3418146)
AA seq 256 aa
MNNAIFPNKFKAALAAQQVQIGCWSALASPITTEVLGLAGFDWLVLDGEHAPNDVTTLIP
QLMALKGSASAPVVRVPTNEPVIIKRMLDIGFYNFLIPFVETQEEAARAVASTRYPPEGI
RGVSVSHRANMFGTVPDYFAQSNKNITIIVQIESQLGVDNVDAIAATEGVDGIFVGPSDL
AAALGHLGNASHPDVQQTIQHIFARAKAHGKPCGILAPVEADARRYLEWGATFVAVGSDL
GAFRASTQKLADTFKK
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaataacgctattttcccgaataagtttaaagcggcgctagcggcgcaacaggtgcag
attggctgctggtctgcactggcaagcccaatcaccaccgaagttctcggtctggcggga
tttgactggctggtgctggatggcgaacatgcgccgaacgatgtgaccaccttaattccg
cagctaatggcattgaaaggcagcgccagcgcgcctgtggtacgtgtgccaaccaatgaa
ccggtcattatcaaacggatgctggatattgggttttataacttcctgatcccctttgtt
gaaacgcaagaggaagcggctcgcgccgtcgcctcgacgcgttacccgccggaaggcatt
cgcggcgtctccgtttctcaccgcgcgaatatgttcggtacggtgcctgattactttgcg
cagtcgaacaaaaacatcaccattattgttcaaatcgaaagccagttgggtgtcgacaat
gttgatgccatcgccgcaacggaaggcgttgatggcatttttgtcggcccaagcgatttg
gccgccgcgctgggtcatctcggcaatgcttctcaccctgacgtgcagcagacgattcaa
catattttcgcccgcgctaaagcgcacggtaaaccgtgcggcattctggcgccggtagag
gcggatgcccgccgttatctggaatggggcgcgacctttgtcgccgttggcagcgattta
ggcgcattccgcgccagcacgcagaagcttgccgacacctttaaaaaataa

DBGET integrated database retrieval system